KEGG   Homo sapiens (human): 6649Help
Entry
6649              CDS       T01001                                 

Gene name
SOD3, EC-SOD
Definition
(RefSeq) superoxide dismutase 3
  KO
K16627  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6649 (SOD3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     6649 (SOD3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes
   6649 (SOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 6649
NCBI-ProteinID: NP_003093
OMIM: 185490
HGNC: 11181
Ensembl: ENSG00000109610
Vega: OTTHUMG00000128565
Pharos: P08294(Tbio)
UniProt: P08294 A0A140VJU8
Structure
PDB: 

Position
4p15.2
AA seq 240 aa AA seqDB search
MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALH
AACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGD
LSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVV
HAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESECKAA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctactgtgttcctgcctgctcctggcagccggtgcctcggacgcctggacg
ggcgaggactcggcggagcccaactctgactcggcggagtggatccgagacatgtacgcc
aaggtcacggagatctggcaggaggtcatgcagcggcgggacgacgacggcgcgctccac
gccgcctgccaggtgcagccgtcggccacgctggacgccgcgcagccccgggtgaccggc
gtcgtcctcttccggcagcttgcgccccgcgccaagctcgacgccttcttcgccctggag
ggcttcccgaccgagccgaacagctccagccgcgccatccacgtgcaccagttcggggac
ctgagccagggctgcgagtccaccgggccccactacaacccgctggccgtgccgcacccg
cagcacccgggcgacttcggcaacttcgcggtccgcgacggcagcctctggaggtaccgc
gccggcctggccgcctcgctcgcgggcccgcactccatcgtgggccgggccgtggtcgtc
cacgctggcgaggacgacctgggccgcggcggcaaccaggccagcgtggagaacgggaac
gcgggccggcggctggcctgctgcgtggtgggcgtgtgcgggcccgggctctgggagcgc
caggcgcgggagcactcagagcgcaagaagcggcggcgcgagagcgagtgcaaggccgcc
tga

DBGET integrated database retrieval system