KEGG   Homo sapiens (human): 6650
Entry
6650              CDS       T01001                                 

Gene name
CAPN15, SOLH
Definition
(RefSeq) calpain 15
  KO
K08582  calpain-15 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6650 (CAPN15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6650 (CAPN15)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   6650 (CAPN15)
SSDB
Motif
Pfam: Peptidase_C2 zf-RanBP DZR
Other DBs
NCBI-GeneID: 6650
NCBI-ProteinID: NP_005623
OMIM: 603267
HGNC: 11182
Ensembl: ENSG00000103326
Vega: OTTHUMG00000119059
Pharos: O75808(Tdark)
UniProt: O75808
Position
16p13.3
AA seq 1086 aa
MATVGEWSCVRCTFLNPAGQRQCSICEAPRHKPDLNHILRLSVEEQKWPCARCTFRNFLG
KEACEVCGFTPEPAPGAAFLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGLVATEPAR
GQCEDKDEEEKEEQEEEEGAAEPRGGWACPRCTLHNTPVASSCSVCGGPRRLSLPRIPPE
ALVVPEVVAPAGFHVVPAAPPPGLPGEGAEANPPATSQGPAAEPEPPRVPPFSPFSSTLQ
NNPVPRSRREVPPQLQPPVPEAAQPSPSAGCRGAPQGSGWAGASRLAELLSGKRLSVLEE
EATEGGTSRVEAGSSTSGSDIIDLAGDTVRYTPASPSSPDFTTWSCAKCTLRNPTVAPRC
SACGCSKLHGFQEHGEPPTHCPDCGADKPSPCGRSCGRVSSAQKAARVLPERPGQWACPA
CTLLNALRAKHCAACHTPQLLVAQRRGAAPLRRRESMHVEQRRQTDEGEAKALWENIVAF
CRENNVSFVDDSFPPGPESVGFPAGDSVQQRVRQWLRPQEINCSVFRDHRATWSVFHTLR
PSDILQGLLGNCWFLSALAVLAERPDLVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDD
MLPCDEAGCLLFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLATLTGAPCESLA
LQLSSTNPREEPVDTDLIWAKMLSSKEAGFLMGASCGGGNMKVDDSAYESLGLRPRHAYS
ILDVRDVQGTRLLRLRNPWGRFSWNGSWSDEWPHWPGHLRGELMPHGSSEGVFWMEYGDF
VRYFDSVDICKVHSDWQEARVQGCFPSSASAPVGVTALTVLERASLEFALFQEGSRRSDA
VDSHLLDLCILVFRATFGSGGHLSLGRLLAHSKRAVKKFVSCDVMLEPGEYAVVCCAFNH
WGPPLPGTPAPQASSPSAGVPRASPEPPGHVLAVYSSRLVMVEPVEAQPTTLADAIILLT
ESRGERHEGREGMTCYYLTHGWAGLIVVVENRHPKAYLHVQCDCTDSFNVVSTRGSLRTQ
DSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGL
HGPRPL
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggccacggtcggagagtggtcctgtgtgcgctgcaccttcctgaacccggccggccag
cgccagtgctccatctgcgaggctccccggcacaagcccgacctcaaccacatcctgcgg
ctcagcgtggaggagcagaaatggccctgcgcccgctgcaccttccgcaacttcctgggc
aaggaggcctgcgaggtgtgcggcttcaccccggagcctgcgcctggggctgccttcctg
ccagtcctcaacggggtcctccccaagccacccgccatcctgggggagcccaagggcagc
tgccaggaggaagcaggtccagtgaggactgcggggctggtggccacggagcccgccagg
gggcagtgcgaggacaaggacgaggaggagaaggaggagcaggaggaggaggagggagcg
gcggagcccagagggggctgggcgtgtccgcgttgcacgctgcacaacacgcccgtggcc
agctcctgctccgtctgcgggggcccacgcaggctctcgctgccacggatccctcctgag
gccctggtggtcccggaagtggtggccccggccggcttccacgtcgtgcctgccgcgcct
ccacctggcctccccggggaaggtgccgaggccaaccccccagccaccagccagggccca
gctgccgaaccagagccgcccagggtcccgcccttcagccccttctcgtccaccctgcag
aacaaccccgtgccgcgcagccgacgcgaggttcccccccagctgcagccaccggtgcct
gaggctgcccagccgtcaccctctgccggctgcaggggagccccccagggctcgggctgg
gctggggcctcccgcctagcagagttgctgtctggcaagcggctgagtgtgctggaggaa
gaggccacggagggtggcaccagccgcgtagaggccggcagctccacctcgggcagtgac
atcattgacctggccggagacaccgtgcgttacacgcccgccagcccctccagccccgac
ttcaccacctggtcatgtgccaagtgcacgctcagaaaccccacagtggcccccaggtgc
tcggcctgcggctgctccaaactgcacggcttccaggagcatggcgagccccccacccac
tgccccgactgtggggccgacaagcccagcccctgcggcagaagctgcggacgggtgtcc
tcggcccagaaggccgcccgcgtcctgcccgagcgcccgggccagtgggcctgccctgcc
tgtaccctgctcaacgcactgcgggccaagcactgcgccgcctgccacacgcctcagctc
ctggtggcccagcggcggggggccgcgcccctgaggcgcagggagagcatgcacgtggag
cagcggcggcagacagacgagggcgaggccaaggcactctgggagaacatcgtggccttc
tgccgggagaacaatgtgagcttcgtggatgacagcttccctcccgggcccgagtctgtc
ggcttccccgcgggtgacagcgtgcagcagcgtgtgaggcagtggctgcgaccccaggag
atcaactgctccgtcttcagggaccacagggccacgtggtctgtgttccacacactgcgg
ccctcagacatcctgcaggggctgctggggaactgctggttcctgagcgccctggcggtg
ctggcggagcggccggacctggtggagcgggtgatggtcacgcgcagcctgtgtgcagag
ggcgcctaccaggtgcggctgtgcaaggacggcacgtggaccacggtgctggtggacgac
atgctgccctgtgatgaggccggctgcctcctcttctcacaggcgcagcggaagcagctg
tgggtggccctcatcgagaaggcgctggccaagctgcacggctcctactttgcgctccag
gcgggccgcgccatcgaaggcctggccacgctcaccggcgccccctgtgagagcctggcg
ctgcagctcagctccactaacccccgcgaggagcccgttgacactgacctcatctgggcc
aaaatgctgagttctaaggaggctgggttcctcatgggtgcctcctgtggcgggggcaac
atgaaggtggacgattcggcctacgagagcctgggcctgcgcccccggcatgcctactcc
atcctggatgtccgagatgtccagggcaccaggcttctgcggctccgaaacccgtggggc
cgtttctcctggaacggcagctggtccgacgagtggccacactggccggggcacctgcgt
ggcgagctcatgccgcacggcagcagtgagggtgtcttctggatggagtacggcgacttt
gtcaggtacttcgactccgtggacatctgtaaggtgcactcggactggcaggaggcgcgg
gtgcagggctgctttcccagctcggccagcgcgcccgtgggggtaacagcgctcacggtg
ctggagcgggcctcgctggagttcgcgctcttccaggagggcagcaggcgctcggacgcc
gtggacagccacctgctggacctgtgcatcctggtgttccgggccacgttcggcagcggc
ggccacctcagcctgggccgcctcctggcccacagtaagcgcgcggtcaagaagttcgtc
agctgcgacgtcatgctggagcctggcgagtacgctgtggtgtgctgcgccttcaaccac
tgggggccgcccctgccgggcacccctgccccccaggcctccagcccctcggcaggggtc
ccgagagcctccccagagccgccgggccacgtgctggctgtgtacagctcgaggctggtc
atggtggagcccgtggaagcccagccgaccacgctggccgacgccatcatcctgctcacc
gagagccgcggagagcggcacgagggccgtgagggcatgacctgctactacctgacacac
ggttgggcggggctcatcgtggtggtggagaaccgacaccccaaggcctacctgcacgtg
cagtgtgactgcaccgacagcttcaacgtggtgtccacacgcggcagcctgcgtacccag
gatagcgtgccacccctgcacaggcaggtcctggtgatcttgtcccagctagagggcaac
gccggcttctctatcacccaccgcctggcacatcgcaaggcagcccaggccttcctcagt
gactggacagcctccaaggggacccacagccccccactcacgccagaggtcgccggtctg
catgggccccgaccgctgtga

DBGET integrated database retrieval system