KEGG   Homo sapiens (human): 666Help
Entry
666               CDS       T01001                                 

Gene name
BOK, BCL2L9, BOKL
Definition
(RefSeq) BCL2 family apoptosis regulator BOK
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    666 (BOK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 TetR_C_20
Motif
Other DBs
NCBI-GeneID: 666
NCBI-ProteinID: NP_115904
OMIM: 605404
HGNC: 1087
Ensembl: ENSG00000176720
Vega: OTTHUMG00000133411
Pharos: Q9UMX3(Tbio)
UniProt: Q9UMX3 A0A024R4A8
Structure
PDB: 

Position
2q37.3
AA seq 212 aa AA seqDB search
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVP
GRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW
GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVS
TDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctgcggcgctcctcggtcttcgccgccgagatcatggacgcctttgaccgc
tcgcccacagacaaggagctggtggcccaggccaaggcgctgggccgggagtacgtgcac
gcgcggctgctgcgcgccggcctctcctggagcgcgcccgagcgtgccgcgccggtcccg
ggacgcctggctgaggtgtgcgcggtgctgctgcgcctgggcgatgagctggagatgatc
cggcccagcgtctaccgcaacgtggcgcgtcagctgcacatctccctgcagtctgagcct
gtggtgaccgatgcgttcctggccgtggctggccacatcttctctgcaggcatcacgtgg
ggcaaggtggtgtccctgtatgcggtggccgcggggctggccgtggactgtgtgaggcag
gcccagcctgccatggtccacgccctcgtggactgcctgggggagttcgtgcgcaagacc
ctggcaacctggctgcggagacgcggcggatggactgatgtcctcaagtgtgtggtcagc
acagaccctggcctccgctcccactggctggtggctgcactctgcagcttcggccgcttc
ctgaaggctgccttcttcgtgctgctgccagagagatga

DBGET integrated database retrieval system