KEGG   Homo sapiens (human): 6667Help
Entry
6667              CDS       T01001                                 

Gene name
SP1
Definition
(RefSeq) Sp1 transcription factor
  KO
K04684  transcription factor Sp1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04137  Mitophagy - animal
hsa04350  TGF-beta signaling pathway
hsa04915  Estrogen signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa05016  Huntington disease
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
Network
N00132  Amplified MYCN to transcriptional repression
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00392  HCMV gB to EGFR-RAS-ERK signaling pathway
Drug target
Terameprocol: D09014
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    6667 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    6667 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    6667 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    6667 (SP1)
   04927 Cortisol synthesis and secretion
    6667 (SP1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6667 (SP1)
   05231 Choline metabolism in cancer
    6667 (SP1)
   05202 Transcriptional misregulation in cancer
    6667 (SP1)
  09162 Cancers: Specific types
   05224 Breast cancer
    6667 (SP1)
  09164 Neurodegenerative diseases
   05016 Huntington disease
    6667 (SP1)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    6667 (SP1)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    6667 (SP1)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    6667 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6667 (SP1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    6667 (SP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 ubiquitous factors
    6667 (SP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    6667 (SP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 6667
NCBI-ProteinID: NP_612482
OMIM: 189906
HGNC: 11205
Ensembl: ENSG00000185591
Vega: OTTHUMG00000170047
Pharos: P08047(Tbio)
UniProt: P08047
Structure
PDB: 

Position
12q13.13
AA seq 785 aa AA seqDB search
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ
TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT
SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS
GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ
TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS
GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW
SYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS
VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI
SGNGF
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaaaattgaaaaagga
gttggtggcaataatgggggcaatggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcactggaggaggagggcaggagtcccagccatcccct
ttggctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaacaac
tcccagggcccgagtcagtcagggggaacaggtgagcttgacctcacagccacacaactt
tcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacctca
aaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaatcgc
acagtctctggtgggcagtatgttgtggctgccgctcccaacttacagaaccagcaagtt
ctgacaggactacctggagtgatgcctaatattcagtatcaagtaatcccacagttccag
accgttgatgggcaacagctgcagtttgctgccactggggcccaagtgcagcaggatggt
tctggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgaggaagt
ggaggcaacatcattgctgctatgccaaacctactccagcaggctgtccccctccaaggc
ctggctaataatgtactctcaggacagactcagtatgtgaccaatgtaccagtggccctg
aatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactcccagc
tctcaggcagtcacgatcagcagctctgggtcccaggagagtggctcacagcctgtcacc
tcagggactaccatcagttctgccagcttggtatcatcacaagccagttccagctccttt
ttcaccaatgccaatagctactcaactactactaccaccagcaacatgggaattatgaac
tttactaccagtggatcatcagggaccaactctcaaggccagacaccccagagggtcagt
gggctacaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctcattg
caagcaggccagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaattctt
atccagcctcagctagttcaagggggacaggccctccaggccctccaagcagcaccattg
tcagggcagacctttacaactcaagccatctcccaggaaaccctccagaacctccagctt
caggctgttccaaactctggtcccatcatcatccggacaccaacagtggggcccaatgga
caggtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagcccaa
acaatcaccttagccccaatgcagggtgtttccttggggcagaccagcagcagcaacacc
actctcacacccattgcctcagctgcttccattcctgctggcacagtcactgtgaatgct
gctcaactctcctccatgccaggcctccagaccattaacctcagtgcattgggtacttca
ggaatccaggtgcacccaattcaaggcctgccgttggctatagcaaatgccccaggtgat
catggagctcagcttggtctccatggggctggtggtgatggaatacatgatgacacagca
ggtggagaggaaggagaaaacagcccagatgcccaaccccaagccggtcggaggacccgg
cgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctcgggggatcct
ggcaaaaagaaacagcatatttgccacatccaaggctgtgggaaagtgtatggcaagacc
tctcacctgcgggcacacttgcgctggcatacaggcgagaggccatttatgtgtacctgg
tcatactgtgggaaacgcttcacacgttcggatgagctacagaggcacaaacgtacacac
acaggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgaccac
ctgtcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagctctgagt
gtgggcactttgcccctggacagtggggcaggttcagaaggcagtggcactgccactcct
tcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggcattgcc
cgtcttgccaacagtggcatcaacgtcatgcaggtggcagatctgcagtccattaatatc
agtggcaatggcttctga

DBGET integrated database retrieval system