KEGG   Homo sapiens (human): 667Help
Entry
667               CDS       T01001                                 

Gene name
DST, BP240, BPA, BPAG1, CATX-15, CATX15, D6S1101, DMH, DT, EBSB2, HSAN6, MACF2
Definition
(RefSeq) dystonin
  KO
K10382  dystonin
Organism
hsa  Homo sapiens (human)
Disease
H00265  Hereditary sensory and autonomic neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    667 (DST)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    667 (DST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin CH GAS2 Spectrin_like SH3_10 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 CAMSAP_CH Laminin_II
Motif
Other DBs
NCBI-GeneID: 667
NCBI-ProteinID: NP_001138241
OMIM: 113810
HGNC: 1090
Ensembl: ENSG00000151914
Vega: OTTHUMG00000014913
Pharos: Q03001(Tbio)
UniProt: Q03001 Q6P0N6 B4DSS9
Structure
PDB: 

Position
6p12.1
AA seq 5675 aa AA seqDB search
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRKLQKGRHPMKSVFSGRSRSR
DAVLRSHHFRSEGFRASPRHLRRRVAAAAAARLEEVKPVVEVHHQSEQETSVRKRRIKKS
SRVQPEFYHSVQGASIRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYED
LRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGN
PKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRD
GKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKS
VITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFPNN
PVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEW
GKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGV
QFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSS
VYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSG
MTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEE
INMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISE
IQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEE
VAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAA
MQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHK
LEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE
ITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNV
LTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLED
SQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENC
EDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSS
VPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVI
ADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKE
KADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPE
NSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKS
PVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEH
VEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKH
GDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYKEK
LQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTE
NFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAA
VKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNG
NLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPE
EKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELEN
LEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTS
ATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATAS
KHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQ
KTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPL
NSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFS
EASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQE
STSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVT
SCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEI
QKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMT
DISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDT
EAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQE
LNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQV
QILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRC
DWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQ
EKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASS
HQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIA
EGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLW
PWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEID
KEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIH
DSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETI
AQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQ
KQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDR
AQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQ
KEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQ
EALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKST
VEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHE
TLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSL
KVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNE
VHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLI
IQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQ
VLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNER
YRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQL
QVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSER
YLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIA
EHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQST
QFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQR
GEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHM
SLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAA
CGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGG
KLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQ
DPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGG
DPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQ
NVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNV
HMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKT
KLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSH
REQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQ
FHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTG
RSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALID
WLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDD
SSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFH
GVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITII
RARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEE
VKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASS
LYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWR
KKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRD
GDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFF
LGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILAD
GASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYG
KPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAA
ARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHR
PTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
NT seq 17028 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcggctttcctcgtcttgctgagaccctacagcatccaatgtgccctcttc
ctcttgttgcttctgctgggcaccatcgccaccatcgtcttcttctgctgctggcaccgc
aagctccagaaagggaggcatccgatgaaatcggtcttctcgggtcgttcaagaagccga
gatgctgttttgagatcgcaccactttcgttctgagggattcagagcaagccctcggcat
cttagaagacgagttgcagcggccgcagctgcccgtctggaagaagtgaagcccgtggtg
gaagttcaccatcagagtgagcaagaaacttcagtgaggaaacgaagaatcaagaagagc
agccgagtccagccagaattttatcactctgttcaaggtgcttcaatcaggaggcctagt
tccgggaacgcgtcctatcgctgctctatgtcttcctctgcggatttttccgatgaggat
gatttcagccagaaatctggctccgcatccccagctccgggagacaccttaccctggaat
ttgcctaaacatgagagatcgaaaagaaagattcaagggggctcagtgctggaccctgcc
gagagggcagtgcttcggatagcagatgaacgggacaaagttcagaagaaaacatttaca
aaatggataaatcagcatctcatgaaggttcgaaaacatgtgaatgatctctatgaagac
ttaagggatggacacaatttgatttctcttttagaggttctttcaggagataccttgccc
agagaaaaaggtcggatgcgttttcacagactacagaatgtacaaattgcacttgactat
ttgaaaagacgccaggtgaaattagtgaatattagaaatgatgacataacagatggaaat
cccaaattgactttgggattaatctggacaataattttgcactttcagatatctgatatc
catgttactggagagtcagaggatatgtctgcaaaagagagattgctactctggacgcag
caggcaacagagggttatgctggaattcggtgtgaaaatttcactacctgctggagagat
ggaaaattatttaatgccatcattcataaatacaggccggacctgatagatatgaatact
gttgctgttcaaagcaaccttgcaaatttagagcatgctttttacgtagcagaaaaaatt
ggtgttataagacttctggaccctgaagatgtcgatgtctcctcacctgatgaaaaatca
gtaataacttacgtgtcatctctctatgatgcatttcctaaagtccctgaaggtggggaa
ggcattggtgcaaatgatgttgaagtcaaatggattgaataccagaatatggtgaactac
ctcatccaatggattagacaccatgtgaccacaatgtctgagagaacatttcctaataat
cctgtagaactgaaggcactttataatcagtatttacagtttaaagaaacagaaattcca
ccaaaggagacagaaaaatcaaaaattaaacgtctatataaattattagagatttggata
gaatttggacgcatcaagctccttcaaggttatcatccaaatgacatagaaaaagagtgg
gggaaactcattattgccatgctagagagagagaaggcccttcgtccagaagtagaaagg
ttagaaatgttgcaacagattgccaacagagttcagagggacagtgtcatctgtgaagac
aaactgattcttgctggaaatgctcttcagtctgattctaaaagattagaatcaggagtg
cagtttcagaatgaagcagaaattgctgggtatatacttgaatgtgagaaccttttacgc
cagcatgtaattgatgtacagattcttattgatggaaaatactaccaggcagatcaattg
gtacagagggttgcaaaactgcgtgacgaaattatggccttaaggaacgaatgttcttct
gtgtacagcaaaggacgcatactgacaacagaacagacaaagctcatgatatcaggaatc
actcaaagtttaaactcaggatttgcacagaccttacaccctagtctgacctcagggctg
acccagagtttaacaccttccctaacctcttctagtatgacttctggcctgtcatcaggg
atgacttcccgcctgactccatctgtcactccagcttatacacctggtttcccatcagga
ttagttccaaatttcagttcaggagtagagccaaattcattgcaaactttgaagttgatg
cagatccgaaaaccccttctaaagtcttctttgctggatcaaaatttaacagaagaagaa
atcaatatgaaatttgttcaggatcttttgaattgggttgatgagatgcaggtacaactg
gaccgcactgagtggggctcagatttgccaagtgttgaaagccatttagaaaatcataaa
aatgttcatagagctattgaagaatttgaatctagtctcaaagaagctaaaatcagtgag
attcaaatgacagcacctcttaaactgacttatgcagaaaagttgcacagattagagagt
cagtatgcaaaactcttgaatacatccaggaatcaagaacggcaccttgatacactccat
aattttgtaagtcgtgcgactaatgaacttatttggttgaatgaaaaagaagaggaggaa
gttgcttatgactggagtgagagaaacaccaacatagctaggaaaaaagattatcatgct
gaattaatgagagaacttgatcaaaaggaagaaaatattaaatcagttcaggagatagca
gagcagctacttctagaaaatcatccagcccggttaactattgaggcctacagagcggca
atgcagacgcagtggagctggatcttacagctctgccagtgtgtggagcagcacataaag
gagaacacagcgtatttcgagtttttcaatgatgccaaagaagctactgattacttaagg
aatctaaaagatgccattcagcggaagtacagctgtgatagatcaagcagcattcacaag
ctagaagaccttgttcaggaatcaatggaagagaaagaagaacttctgcagtacaaaagc
actatagcaaacctaatgggaaaagcaaaaacaataattcaactgaagccaaggaattct
gactgtccactcaaaacttctattccgatcaaagctatctgtgactacagacaaattgag
ataaccatttacaaagacgatgaatgtgttttggcgaataactctcatcgtgctaaatgg
aaggtcattagtcctactgggaatgaggctatggtcccatctgtgtgcttcaccgttcct
ccaccaaacaaagaagcggtggaccttgccaacagaattgagcaacagtatcagaatgtc
ctgactctttggcatgagtctcacataaacatgaagagtgtagtatcctggcattatctc
atcaatgaaattgatagaattcgagctagcaatgtggcttcaataaagacaatgctacct
ggtgaacatcagcaagttctaagtaatctacaatctcgttttgaagattttctggaagat
agccaggaatcccaagtcttttcaggctcagatataacacaactggaaaaggaggttaat
gtatgtaagcagtattatcaagaacttcttaaatctgcagaaagagaggagcaagaggaa
tcagtttataatctctacatctctgaagttcgaaacattagacttcggttagagaactgt
gaagatcggctgattagacagattcgaactcccctggaaagagatgatttgcatgaaagt
gtgttcagaatcacagaacaggagaaactaaagaaagagctggaacgacttaaagatgat
ttgggaacaatcacaaataagtgtgaggagtttttcagtcaagcagcagcctcttcatca
gtccctaccctacgatcagagcttaatgtggtccttcagaacatgaaccaagtctattct
atgtcttccacttacatagataagttgaaaactgttaacttggtgttaaaaaacactcaa
gctgcagaagccctcgtaaaactctatgaaactaaactgtgtgaagaagaagcagttata
gctgacaagaataatattgagaatctaataagtactttaaagcaatggagatctgaagta
gatgaaaagagacaggtattccatgccttagaggatgagttgcagaaagctaaagccatc
agtgatgaaatgtttaaaacgtataaagaacgggaccttgattttgactggcacaaagaa
aaagcagatcaattagttgaaaggtggcaaaatgttcatgtgcagattgacaacaggtta
cgggacttagagggcattggcaaatcactgaagtactacagagacacttaccatccttta
gatgattggatccagcaggttgaaactactcagagaaagattcaggaaaatcagcctgaa
aatagtaaaaccctagccacacagttgaatcaacagaagatgctggtgtccgaaatagaa
atgaaacagagcaaaatggacgagtgtcaaaaatatgcagaacagtactcagctacagtg
aaggactatgaattacaaacaatgacctaccgggccatggtagattcacaacaaaaatct
ccagtgaaacgccgaagaatgcagagttcagcagatctcattattcaagagttcatggac
ctaaggactcgatatactgccctggtcactctcatgacacaatatattaaatttgctggt
gattcattgaagaggctggaagaggaggagaagtcactggaagaagaaaagaaagaacat
gttgaaaaagccaaagaattgcaaaaatgggtatcaaatatcagcaagacattgaaagat
gcagagaaggctggaaaacctcccttctctaagcaaaagatttccagtgaggaaatatca
accaagaaggaacaattatcggaagcacttcaaactatacagctttttttggcaaaacat
ggagacaaaatgacagatgaagaaagaaatgaattggaaaaacaagtgaaaactcttcag
gaaagttataatttattattcagtgaatctctgaaacagctacaagaatcacaaacctca
ggagatgtaaaggtagaggagaagattgtagcagagcgtcagcaggagtataaagagaaa
ctccaagggatatgtgatcttcttacccaaactgaaaaccgcctaattggtcaccaagaa
gccttcatgattggagatggcacagttgagttaaagaaatatcagtccaagcaagaggaa
ttacagaaagatatgcaaggaagtgcacaggcattggctgaagtagtgaaaaacacagag
aacttcttaaaagagaatggtgaaaagctgtcacaggaagataaggctttgattgaacag
aaacttaatgaagctaagataaagtgtgaacagcttaatttaaaagcagaacagtctaaa
aaggagctggataaagttgtgacaacagcaatcaaggaagaaactgaaaaggtagcagca
gtgaagcagctggaagagagcaaaaccaaaatagaaaaccttttggactggttgtcaaat
gttgacaaagactcagaaagggcagggacaaaacacaaacaggtaatcgaacagaacggg
acccattttcaagaaggtgatggcaagtcagcaattggagaagaggatgaagttaatggt
aacctgttggagactgatgttgatgggcaagttggaaccactcaggagaatctgaatcag
caatatcagaaagttaaggcccaacacgagaagatcatctctcagcaccaagcagtgatc
atagccactcagtctgcacaagtgttgcttgagaaacagggtcagtatctctctcctgaa
gaaaaagagaaactgcaaaagaacatgaaggaactgaaagtgcattatgaaactgcactg
gctgagtcagagaagaaaatgaagttaactcactctctgcaggaagaattagaaaagttt
gatgctgactataccgagtttgagcactggctacagcagtcagaacaagaacttgaaaac
ctggaggcaggtgcagatgacatcaatggtttaatgaccaaattgaagaggcagaagagt
ttctcagaagacgttatttctcacaaaggtgacttgagatacatcacaatttctggaaac
agagtgttggaagctgccaaatcttgcagcaagagagacggtggcaaggttgatacttct
gcaacccacagagaagtgcagcgcaagttggatcatgctactgatcggttcaggtctctc
tactctaagtgcaatgttcttggaaataatcttaaagatctggtggataaatatcaacac
tatgaagatgcttcatgtggacttcttgctggactccaggcctgtgaggccacagcgagc
aaacacttatctgaacctattgcggtggaccccaaaaatcttcaaaggcaattagaagag
accaaggctttgcaaggacagatatcaagtcagcaggttgctgtagagaaactgaagaaa
acggctgaagtgcttttagatgccaggggatctttacttccagccaagaatgatatccag
aaaacacttgatgacattgttgggagatatgaggatctgtccaagtctgttaatgaacga
aatgaaaaactccagataaccttgacccgttcactgagtgtgcaggatggcttggatgaa
atgctggactggatgggaaatgtggaaagttctctgaaagaacaaggtcaagtgccttta
aactctactgctcttcaggatattatcagtaaaaacattatgttggaacaggatattgca
ggtcgtcagagcagtataaatgccatgaatgaaaaagtgaagaaatttatggaaacaaca
gatccatccactgcatcctcactgcaagccaaaatgaaagacttgtctgctcggttttca
gaagcaagtcataaacacaaagaaactcttgccaaaatggaggagctaaaaaccaaagta
gaactgtttgagaacctctcagaaaagctccagacatttttagaaacaaaaactcaggct
cttactgaagtagatgtgccaggaaaagatgttactgaattgtctcagtatatgcaggaa
tcaacttctgaatttttagaacacaagaaacatcttgaagttttgcatagtctcttgaag
gagatatccagccatggcttaccaagtgataaggctttggtccttgaaaaaacaaataat
ttgtcaaagaaattcaaggaaatggaggataccatcaaagaaaaaaaagaagctgtaact
tcttgtcaagaacagttggatgctttccaagttcttgttaaatcattgaagtcatggata
aaagaaacaacaaaaaaagttcccattgtacagccttcttttggtgcagaggatttagga
aaatctttggaagacactaagaaattacaagaaaagtggagtttaaaaacaccagagatt
cagaaagtaaacaacagtgggatctcactatgtaacttaataagtgctgtgaccacccct
gcaaaggcaatagcagcagttaaatcaggtggagcagtattaaatggtgaaggaacagcc
acaaatactgaggaattttgggcaaataaaggtttaacatccattaaaaaggacatgact
gacataagtcatggttatgaagatcttggcctcttactcaaggacaaaatagcggaactg
aacactaaactctccaaattgcaaaaggctcaggaagaatcaagtgcaatgatgcagtgg
ttacagaaaatgaacaaaactgcaacaaaatggcagcagacacctgcacctacagatact
gaagctgtgaagactcaagttgagcagaataagtcgtttgaggcagaactgaagcagaat
gtaaacaaagtacaggagttgaaagacaaattgacagagctgttggaggagaacccagat
actcctgaggcccccagatggaaacagatgttgacagaaatagattctaagtggcaagaa
ctcaatcaattaacaattgatagacaacaaaaactggaagaatcctccaataatctaacc
cagttccagactgtagaggcccaattgaaacagtggcttgtggaaaaagaacttatggtc
agtgttcttgggcccttgtcaattgacccaaatatgctaaacacacaaaggcagcaggtg
cagattttgctgcaagaattcgccactcggaaacctcaatatgaacagctgacagcagct
ggtcagggcattctgagcaggcctggagaagacccttctttacgtgggattgtgaaagag
caactggcagctgtgacccaaaaatgggatagcctaacagggcaattgagtgacagatgt
gactggattgaccaagccattgttaaaagcacacagtatcaaagcctgctgagaagcctt
tctgataaactgagtgacttggataataaactcagcagcagtctggctgtgagcacgcac
cctgatgctatgaaccaacagttggaaacagcccaaaaaatgaagcaggagatacagcag
gaaaagaagcagataaaagtggcccaggcactctgtgaggatttgtcagcactggttaaa
gaagagtacttgaaagcagaacttagtaggcaactagaaggcatcttaaaatcatttaag
gatgttgaacagaaagcagagaatcatgtccagcaccttcagtcggcctgtgcaagctct
catcaatttcagcaaatgtctagagattttcaggcttggctggatacaaagaaagaagag
caaaacaaatctcatccaatatctgccaaactcgatgtcttggagtcattaattaaagat
cataaagactttagtaaaactttgaccgctcagtctcatatgtatgaaaaaaccattgca
gaaggtgaaaatctgttattaaaaacacaagggtctgagaaggcagccttacagttacag
cttaatacaattaaaaccaattgggatacatttaataagcaggtgaaagaaagagaaaac
aagttaaaagagtcattggaaaaagcccttaagtataaagagcaagtagagactctctgg
ccatggatagacaaatgccaaaacaacctggaggaaataaaattttgcttggatcctgct
gaaggagagaattctattgccaagttaaagtctctgcagaaggaaatggaccaacacttt
ggtatggtagaattactgaacaacacagccaatagcttgctcagtgtctgtgagatagat
aaagaagttgttacagatgagaataagtcactgatccagaaggtggacatggtcactgaa
caacttcacagtaagaaattctgtctggagaacatgactcagaagtttaaagaatttcaa
gaagtttccaaagaatctaaaaggcagcttcagtgtgcaaaggagcagctagatatccat
gattcgctgggatcccaggcttacagtaacaaatacctgaccatgttgcaaactcagcag
aaatcacttcaggccttgaagcatcaggtagatttggctaaaagacttgcacaggacctt
gtggtagaggcctcagactcaaagggaacctctgatgttttattacaagtggaaaccata
gctcaagagcatagtacactaagtcagcaggttgatgaaaagtgttctttcttagaaacc
aagcttcagggcattgggcatttccagaataccattcgagaaatgttttctcagttcgca
gagtttgatgatgaactggatagcatggctccagtggggagagatgcagaaacattgcaa
aagcaaaaggaaactataaaagcctttctaaagaaactagaagccctcatggcaagcaat
gacaatgccaataaaacctgcaagatgatgttagccacagaagaaacctctcctgacctt
gttggaatcaaaagggacttggaggccttaagcaaacaatgcaacaagttactggaccga
gcccaagccagagaagagcaggttgaagggacaattaagcgccttgaagaattttacagc
aaattgaaagaattttctattctgctccagaaagccgaagaacatgaagagtcacaaggt
cctgttggtatggaaacggagacaattaatcagcagcttaacatgttcaaggtattccag
aaagaagagattgaacccttgcaaggtaaacagcaagatgtaaactggttaggtcaaggc
cttattcagagtgctgccaaaagcactagcactcagggcttggagcatgacctggatgat
gtcaatgcacggtggaagactctcaataagaaggtggctcagcgagcagcccagctgcag
gaggccttgctgcactgtgggaggttccaggatgccctggagtccctgctcagctggatg
gtggacactgaggagcttgtggccaatcagaagcccccgtcggctgagttcaaagtggta
aaggcccagatacaagaacaaaagcttctccagagattgttggatgaccgaaaatctacg
gtggaggtaatcaaacgagaaggagaaaaaattgctacaacagcagagcccgcagataaa
gtgaagattttgaaacagctcagtctcttggatagcagatgggaggcattgcttaataaa
gctgaaacaaggaatcgtcagttggaaggtatctcggtggtagcacagcaatttcatgaa
accttagaaccactgaacgagtggcttacaaccatagaaaagaggctggtgaattgtgaa
cccataggaacccaagcatctaaacttgaggaacaaattgcacagcacaaagccttagaa
gatgacatcatcaatcacaataaacatttacaccaggctgttagcattggccagtcctta
aaggttttgagctccagggaggataaagatatggtgcagagtaaattagacttctctcaa
gtatggtacattgagattcaagagaaaagtcacagcaggtctgagctcctccagcaggcc
ttatgtaatgctaagatttttggggaagatgaagttgaactgatgaactggctgaatgaa
gtgcatgacaaactgagcaagctctcagtccaggattacagcactgaggggctatggaag
cagcagtctgaacttcgggttctgcaagaggacatcttactcaggaaacaaaatgtagat
caggctttactaaatggtttagaactacttaaacaaaccacaggtgatgaagttttaata
attcaagataaattggaagccattaaagcaaggtacaaagacattactaaactgagcact
gatgtggccaagactctggaacaggcgctgcagcttgcaaggcggctgcactccacacac
gaagagctgtgtacctggctggacaaagtggaggtggaattactttcatatgaaactcag
gttctgaaaggagaagaagcaagtcaagcacaaatgagaccaaaggaactgaaaaaggaa
gctaagaacaacaaagccttactggactcccttaatgaagtgagcagtgctttgctggaa
ctggtaccatggagggcaagagaaggacttgagaaaatggtagctgaggacaatgagcgc
taccgattagtgagcgacaccatcactcagaaggtggaggagatcgatgcagccattctg
cgatcacagcagtttgaccaagcagctgatgctgagttatcctggattactgaaacagaa
aaaaaattgatgtctctgggtgacatcaggcttgagcaagaccagacttctgctcagctt
caagttcaaaagacattcaccatggagattttgagacacaaggatattattgatgacctt
gttaaatctgggcataaaatcatgaccgcatgcagtgaagaggaaaagcaatcaatgaag
aaaaaactggacaaggtactgaagaactatgataccatctgccagattaattcagaaagg
tatctgcagctggaacgggcacagtccctggttaaccaattctgggaaacatatgaagaa
ctttggccatggctgacagaaacacaatcaatcatctctcagcttcccgccccagccctt
gaatatgaaactctaaggcagcagcaggaagaacatcggcaactgcgtgagttgatagct
gaacacaagcctcatatagataagatgaacaaaactgggccacagttactggaattgagc
cctggggaaggcttttctatccaagagaagtatgtggcagccgacaccctttacagtcaa
attaaagaagatgtcaaaaagcgtgctgtggcactggatgaagccatttctcaatcaact
cagttccatgacaagatagatcagatccttgagagcctggaacgcatcgtggaacgtctg
aggcagccaccctctatctctgcagaggttgagaagatcaaggaacagatcagtgaaaat
aagaatgtgtcagtagacatggaaaagctacagccgttgtatgaaactcttaaacagagg
ggagaggaaatgattgctagatctggggggactgataaagacatatctgccaaagctgtt
caggataagcttgaccaaatggttttcatttgggagaacatacacacactggtggaagag
agggaagccaaactactggatgtgatggagctagcagaaaagttctggtgtgatcacatg
tcattgatagttaccattaaagatactcaagatttcatccgggacctggaagatcctgga
attgatccttcagtagtaaaacaacagcaagaagcagcagagaccataagggaagaaata
gatggactacaggaggagctggatatagttattaacctaggttctgaactcattgcggca
tgtggggagcctgataaacccattgtcaagaagagtatagatgagttaaattcagcatgg
gattctctaaataaagcttggaaagaccggattgacaaacttgaggaggcaatgcaggct
gccgttcagtaccaggatggactgcaggcggtatttgactgggtagatattgcaggtggt
aaattagcttcaatgtctccaattggaacagatctcgaaactgtcaagcagcagattgaa
gagctaaagcaatttaagtctgaggcctatcaacagcagatagaaatggaaagactgaat
catcaagcagagcttttgctaaagaaagtaacagaagagagtgacaaacacactgttcaa
gacccattaatggaactgaaattgatatgggatagcctggaggagagaatcatcaacaga
cagcataaactggagggtgctctattagccttgggtcagttccaacatgccctggatgag
ctcctggcatggctgacacacaccgagggcttgctaagtgagcagaaacctgttggagga
gaccctaaagccattgaaattgaacttgccaagcatcatgtgctccaaaatgatgtatta
gcccatcagtccacagtggaagccgttaataaagcaggaaatgatctaattgaatcaagt
gcaggagaagaagcaagcaaccttcagaacaagctagaggttttaaatcaacgctggcaa
aatgttttggaaaaaacagaacaaaggaagcagcagctggatggtgccttgcgccaggcc
aaagggttccatggcgaaattgaggatttgcagcagtggctgactgacacggagcgtcat
ctgttggcatctaaaccgctgggaggtttaccggaaacagccaaggagcagcttaatgtc
catatggaagtctgtgctgcctttgaagctaaagaagaaacatataagagtctgatgcag
aaaggccagcagatgcttgcaagatgcccaaaatctgcagagacaaatattgaccaagac
ataaataacttgaaagaaaaatgggaatcggtggaaaccaaactcaatgaaaggaaaact
aaactggaagaggctctcaacttggcaatggagttccacaattctctccaagacttcatc
aactggcttactcaggctgaacagaccctaaatgtagcttctcggccaagtctcatcttg
gacacagtcttatttcaaattgacgaacacaaggtttttgccaatgaagtaaattctcat
cgtgagcagataatagagctggacaaaactggaacccacctaaaatattttagtcagaaa
caagatgttgttctaatcaagaatctacttatcagtgtacaaagtcgatgggaaaaagtg
gttcaacggttggtagagagaggaagatctttggatgatgcaaggaagagagccaagcag
ttccatgaagcttggagtaaacttatggagtggctagaagagtcagaaaagtctttggat
tctgaactggaaatcgcaaatgatccagacaaaataaaaacacaacttgcacaacataag
gagtttcagaaatcactcggagccaagcattctgtctacgacaccaccaacaggactgga
cgttctctgaaggagaaaacctccctggctgatgacaacctgaaactggatgacatgctg
agtgaactcagagacaaatgggataccatatgtggaaaatctgtggaaagacaaaacaaa
ttggaggaagccctgttattttctggacaattcacagatgccctacaggctctcattgat
tggttatatagagttgaaccccagctggcagaagaccagcctgttcatggagacattgat
ttggtgatgaatctgatcgataatcacaaggccttccaaaaagagttggggaagaggacc
agcagtgtgcaggccctgaagcgctcagcccgagaactcatagaaggcagtcgggatgac
tcctcctgggtcaaggtccagatgcaggaattaagcacacgctgggagaccgtgtgtgca
ctttctatatcaaagcaaacacggttagaagcagccctgcgtcaggcagaggaattccac
tcggtggtacatgccctcttggagtggctggctgaggcggagcaaaccctgcgtttccat
ggtgtcctcccagatgatgaggatgctctccggactctcattgatcagcataaagaattc
atgaagaaactggaagaaaagagagctgaactaaataaagccaccactatgggcgacacc
gttttggctatctgccaccccgactccatcactaccattaagcactggataacaatcatc
cgggcgaggtttgaggaggtgctggcctgggcaaagcaacatcagcagagattagcaagt
gctctggctgggcttattgccaaacaggaattgttggaagctttgctggcttggttgcaa
tgggctgaaactacacttactgataaggataaagaagtcatcccccaggagatcgaagag
gtgaaagcactcattgcagaacaccagaccttcatggaggaaatgaccagaaaacagcct
gatgttgataaagtaacgaagacctataagaggagagctgctgatccttcctcattacaa
tcccatattccagtcttggataagggacgagcaggaagaaaacgctttccagcatcaagc
ttgtatccctctgggtcacagacacaaattgaaaccaaaaatcctagggtaaacttactg
gtgagcaaatggcagcaagtctggctcctggcgttggaaagaaggaggaaactcaatgat
gccttggacagactagaggagctgagggaatttgctaactttgattttgatatctggcgc
aaaaaatacatgcgatggatgaatcacaagaaatctcgagtgatggacttcttcaggaga
attgataaagaccaggatgggaaaataacgcggcaggaatttattgatggaattctttcc
tcaaagtttccaaccagtcgcttggagatgagcgcagttgcagacatctttgacagagat
ggcgatggatatattgactactatgaatttgtagcagcccttcacccaaataaagatgca
tataaacctatcacagatgccgacaaaatcgaagatgaggtgacaaggcaggtagctaag
tgtaaatgtgcaaagcgatttcaagttgagcagattggtgataataaatacaggttcttc
ctgggaaatcagtttggagactcccagcaactgcgactggtccggatcctgcggagtact
gtgatggttcgtgttggaggtggatggatggcacttgatgagttcttagtgaaaaatgat
ccttgcagggccaaaggaaggacaaacatggaactgcgtgagaagttcattttagcagat
ggtgccagccagggtatggctgctttccgaccccgaggccgaagatcccggccatcatca
cgaggcgcttcacccaacagatccacttctgtgtccagtcaggctgcgcaggcggcctcc
ccacaggtccctgccaccaccacacccaagattctccatcctttaacacgcaattatggt
aaaccatggttgacaaacagcaaaatgtcaactccttgtaaagcagcagagtgctcagac
tttcccgtgccatctgcagagggaacgccaatacaaggaagcaagcttcgacttccagga
tatttatcagggaaaggcttccactctggggaggacagtggcttgataacaactgcagct
gccagagtccgaacacagtttgctgattccaagaagactcccagccgaccaggaagtcga
gctggaagcaaagctggcagcagggccagcagccgccgaggcagtgatgcatcagacttt
gacatttcagaaatccagtccgtgtgctcagatgtggaaactgtcccccagacacacaga
cctacaccccgagcaggttctcggccatccacagcgaagccttcaaaaatccccacgccc
cagaggaaatcacctgccagcaaattggacaagtcctcaaagagatag

DBGET integrated database retrieval system