KEGG   Homo sapiens (human): 6670Help
Entry
6670              CDS       T01001                                 

Gene name
SP3, SPR2
Definition
(RefSeq) Sp3 transcription factor
  KO
K09193  transcription factor Sp3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6670 (SP3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 ubiquitous factors
    6670 (SP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-Di19 zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 6670
NCBI-ProteinID: NP_003102
OMIM: 601804
HGNC: 11208
Ensembl: ENSG00000172845
Vega: OTTHUMG00000132333
Pharos: Q02447(Tbio)
UniProt: Q02447 Q86TP0
Position
2q31.1
AA seq 781 aa AA seqDB search
MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLA
LLAATCSKIGPPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIK
DEAGNLVQIPSAATSSGQYVLPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSAD
GQQVQIGFTGSSDNGGINQESSQIQIIPGSNQTLLASGTPSANIQNLIPQTGQVQVQGVA
IGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTG
QAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSS
GQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT
IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQ
NTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGE
NADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVAC
TCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGK
RFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVE
AARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETM
E
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccgaaaagcccgtgaaacaagaggaaatggctgccttggacgtggatagc
ggcggcggcggtggcggcggcggcggccacggcgagtatctgcagcagcagcaacagcac
ggaaacggtgcggtggcggcggcagcggcggcccaggacactcagccgtcaccgctcgct
ctgctggccgctacctgcagcaagatagggccgccatcgccgggcgacgacgaggaggag
gcggccgccgcagccggggcccccgccgccgccggagcgacaggtgatttggcttctgca
cagttaggaggagcaccaaaccgatgggaggttttgtcagccacacctacaactataaaa
gatgaagctggtaatctagtccagattccaagtgctgctacttcaagtgggcagtatgtt
cttccccttcagaatttgcagaatcaacaaatattttccgttgcaccaggatcagattca
tcaaatggtacagtgtccagtgttcaatatcaagtgataccacagatccagtcagcagat
ggtcagcaggttcaaattggtttcacaggctcttcagataatgggggtataaatcaagaa
agcagtcaaattcagatcattcctggctctaatcaaaccttacttgcctctggaacacct
tctgctaacatccagaatctcataccacagactggtcaagtccaggttcagggagttgca
attggtggttcatcttttcctggtcaaacccaagtagttgctaatgtgcctcttggtctg
ccaggaaatattacgtttgtaccaatcaatagtgtcgatctagattctttgggactctcg
ggcagttctcagacaatgactgcaggcattaatgccgacggacatttgataaacacagga
caagctatggatagttcagacaattcagaaaggactggtgagcgggtttctcctgatatt
aatgaaactaatactgatacagatttatttgtgccaacatcctcttcatcacagttgcct
gttacgatagatagtacaggtatattacaacaaaacacaaatagcttgactacatctagt
gggcaggttcattcttcagatcttcagggaaattatatccagtcgcctgtttctgaagag
acacaggcacagaatattcaggtttctacagcacagcctgttgtacagcatctacaactt
caagagtctcagcagccaaccagtcaagcccaaattgtgcaaggtattacaccacagaca
atccatggtgtgcaagccagtggtcaaaatatatcacaacaggctttgcaaaatcttcag
ttgcagctgaatcctggaacctttttaattcaggcacagacagtgaccccttctggacag
gtaacttggcaaacgtttcaagtacaaggggtccagaacttgcagaatttgcaaatacag
aatactgctgcccaacaaataactttgacgcctgttcaaaccctcacacttggtcaagtt
gcggcaggtggagccttcacttcaactccagttagtctaagcactggtcagttgccaaat
ctacaaacagttacagtgaactctatagattctgctggtatacagctacatccaggagag
aatgctgacagtcctgcagatattaggatcaaggaagaagaacctgatcctgaagagtgg
cagctcagtggtgattctaccttgaataccaatgacctaacacacttaagagtacaggtg
gtagatgaagaaggggaccaacaacatcaagaaggaaaaagacttcggagggtagcttgc
acctgtcccaactgtaaagaaggtggtggaagaggtaccaatcttgggaaaaagaagcaa
cacatttgtcatataccaggatgtggtaaagtctatgggaagacctcacatctgagagct
catctgcgttggcattctggagaacgcccttttgtttgtaactggatgtactgtggtaaa
agatttactcgaagtgatgaattacagaggcacagaagaacacatacaggtgagaagaaa
tttgtttgtccagaatgttcaaaacgctttatgagaagtgaccaccttgccaaacatatt
aaaacacaccagaataaaaaaggtattcactctagcagtacagtgctggcatctgtggaa
gctgcgcgagatgatactttgattactgcaggaggaacaacgcttatccttgcaaatatt
caacaaggttctgtttcagggataggaactgttaatacttccgccaccagcaatcaagat
atccttaccaacactgaaatacctttacagcttgtcacagtttctggaaatgagacaatg
gagtaa

DBGET integrated database retrieval system