KEGG   Homo sapiens (human): 6677Help
Entry
6677              CDS       T01001                                 

Gene name
SPAM1, HEL-S-96n, HYA1, HYAL1, HYAL3, HYAL5, PH-20, PH20, SPAG15
Definition
(RefSeq) sperm adhesion molecule 1
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    6677 (SPAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    6677 (SPAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6677 (SPAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    6677 (SPAM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     6677 (SPAM1)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   6677 (SPAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes
   6677 (SPAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  6677 (SPAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_56 DUF2180 GA-like
Motif
Other DBs
NCBI-GeneID: 6677
NCBI-ProteinID: NP_001167515
OMIM: 600930
HGNC: 11217
Ensembl: ENSG00000106304
Vega: OTTHUMG00000157284
Pharos: P38567(Tbio)
UniProt: P38567 Q5D1J4
Position
7q31.32
AA seq 509 aa AA seqDB search
MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFC
LGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISL
QDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLS
LTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFN
VEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV
FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMET
ILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK
PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQI
FYNASPSTLSATMFIVSILFLIISSVASL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgctaaaattcaagcacatctttttcagaagctttgttaaatcaagtggagta
tcccagatagttttcaccttccttctgattccatgttgcttgactctgaatttcagagca
cctcctgttattccaaatgtgcctttcctctgggcctggaatgccccaagtgaattttgt
cttggaaaatttgatgagccactagatatgagcctcttctctttcataggaagcccccga
ataaacgccaccgggcaaggtgttacaatattttatgttgatagacttggctactatcct
tacatagattcaatcacaggagtaactgtgaatggaggaatcccccagaagatttcctta
caagaccatctggacaaagctaagaaagacattacattttatatgccagtagacaatttg
ggaatggctgttattgactgggaagaatggagacccacttgggcaagaaactggaaacct
aaagatgtttacaagaataggtctattgaattggttcagcaacaaaatgtacaacttagt
ctcacagaggccactgagaaagcaaaacaagaatttgaaaaggcagggaaggatttcctg
gtagagactataaaattgggaaaattacttcggccaaatcacttgtggggttattatctt
tttccggattgttacaaccatcactataagaaacccggttacaatggaagttgcttcaat
gtagaaataaaaagaaatgatgatctcagctggttgtggaatgaaagcactgctctttac
ccatccatttatttgaacactcagcagtctcctgtagctgctacactctatgtgcgcaat
cgagttcgggaagccatcagagtttccaaaatacctgatgcaaaaagtccacttccggtt
tttgcatatacccgcatagtttttactgatcaagttttgaaattcctttctcaagatgaa
cttgtgtatacatttggcgaaactgttgctctgggtgcttctggaattgtaatatgggga
accctcagtataatgcgaagtatgaaatcttgcttgctcctagacaattacatggagact
atactgaatccttacataatcaacgtcacactagcagccaaaatgtgtagccaagtgctt
tgccaggagcaaggagtgtgtataaggaaaaactggaattcaagtgactatcttcacctc
aacccagataattttgctattcaacttgagaaaggtggaaagttcacagtacgtggaaaa
ccgacacttgaagacctggagcaattttctgaaaaattttattgcagctgttatagcacc
ttgagttgtaaggagaaagctgatgtaaaagacactgatgctgttgatgtgtgtattgct
gatggtgtctgtatagatgcttttctaaaacctcccatggagacagaagaacctcaaatt
ttctacaatgcttcaccctccacactatctgccacaatgttcattgttagtattttgttt
cttatcatttcttctgtagcgagtttgtaa

DBGET integrated database retrieval system