KEGG   Homo sapiens (human): 6678Help
Entry
6678              CDS       T01001                                 

Gene name
SPARC, BM-40, OI17, ON
Definition
(RefSeq) secreted protein acidic and cysteine rich
Organism
hsa  Homo sapiens (human)
Disease
H00506  Osteogenesis imperfecta
SSDB OrthologParalogGFIT
Motif
Pfam: SPARC_Ca_bdg Kazal_1 Kazal_2 FOLN EF-hand_1 hEGF
Motif
Other DBs
NCBI-GeneID: 6678
NCBI-ProteinID: NP_003109
OMIM: 182120
HGNC: 11219
Ensembl: ENSG00000113140
Vega: OTTHUMG00000130122
Pharos: P09486(Tbio)
UniProt: P09486
Structure
PDB: 

Position
5q33.1
AA seq 303 aa AA seqDB search
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagggcctggatcttctttctcctttgcctggccgggagggccttggcagcccctcag
caagaagccctgcctgatgagacagaggtggtggaagaaactgtggcagaggtgactgag
gtatctgtgggagctaatcctgtccaggtggaagtaggagaatttgatgatggtgcagag
gaaaccgaagaggaggtggtggcggaaaatccctgccagaaccaccactgcaaacacggc
aaggtgtgcgagctggatgagaacaacacccccatgtgcgtgtgccaggaccccaccagc
tgcccagcccccattggcgagtttgagaaggtgtgcagcaatgacaacaagaccttcgac
tcttcctgccacttctttgccacaaagtgcaccctggagggcaccaagaagggccacaag
ctccacctggactacatcgggccttgcaaatacatccccccttgcctggactctgagctg
accgaattccccctgcgcatgcgggactggctcaagaacgtcctggtcaccctgtatgag
agggatgaggacaacaaccttctgactgagaagcagaagctgcgggtgaagaagatccat
gagaatgagaagcgcctggaggcaggagaccaccccgtggagctgctggcccgggacttc
gagaagaactataacatgtacatcttccctgtacactggcagttcggccagctggaccag
caccccattgacgggtacctctcccacaccgagctggctccactgcgtgctcccctcatc
cccatggagcattgcaccacccgctttttcgagacctgtgacctggacaatgacaagtac
atcgccctggatgagtgggccggctgcttcggcatcaagcagaaggatatcgacaaggat
cttgtgatctaa

DBGET integrated database retrieval system