KEGG   Homo sapiens (human): 669Help
Entry
669               CDS       T01001                                 

Gene name
BPGM, DPGM, ECYT8
Definition
(RefSeq) bisphosphoglycerate mutase
  KO
K01837  bisphosphoglycerate/phosphoglycerate mutase [EC:5.4.2.4 5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
Disease
H00664  Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    669 (BPGM)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    669 (BPGM)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.4  bisphosphoglycerate mutase
     669 (BPGM)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     669 (BPGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Exc
Motif
Other DBs
NCBI-GeneID: 669
NCBI-ProteinID: NP_001280014
OMIM: 613896
HGNC: 1093
Ensembl: ENSG00000172331
Vega: OTTHUMG00000155380
Pharos: P07738(Tbio)
UniProt: P07738 A0A024R782
Structure
PDB: 

Position
7q33
AA seq 259 aa AA seqDB search
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtacaaacttattatgttaagacatggagagggtgcttggaataaggagaac
cgtttttgtagctgggtggatcagaaactcaacagcgaaggaatggaggaagctcggaac
tgtgggaagcaactcaaagcgttaaactttgagtttgatcttgtattcacatctgtcctt
aatcggtccattcacacagcctggctgatcctggaagagctaggccaggaatgggtgcct
gtggaaagctcctggcgtctaaatgagcgtcactatggggccttgatcggtctcaacagg
gagcagatggctttgaatcatggtgaagaacaagtgaggctctggagaagaagctacaat
gtaaccccgcctcccattgaggagtctcatccttactaccaagaaatctacaacgaccgg
aggtataaagtatgcgatgtgcccttggatcaactgccacggtcggaaagcttaaaggat
gttctggagagactccttccctattggaatgaaaggattgctcccgaagtattacgtggc
aaaaccattctgatatctgctcatggaaatagcagtagggcactcctaaaacacctggaa
ggtatctcagatgaagacatcatcaacattactcttcctactggagtccccattcttctg
gaattggatgaaaacctgcgtgctgttgggcctcatcagttcctgggtgaccaagaggcg
atccaagcagccattaagaaagtagaagatcaaggaaaagtgaaacaagctaaaaaatag

DBGET integrated database retrieval system