KEGG   Homo sapiens (human): 6690Help
Entry
6690              CDS       T01001                                 

Gene name
SPINK1, PCTT, PSTI, Spink3, TATI, TCP
Definition
(RefSeq) serine peptidase inhibitor, Kazal type 1
Organism
hsa  Homo sapiens (human)
Disease
H00932  Tropical calcific pancreatitis
H00933  Hereditary pancreatitis
SSDB OrthologParalogGFIT
Motif
Pfam: Kazal_1 Kazal_2 zf-UBP_var DPBB_1
Motif
Other DBs
NCBI-GeneID: 6690
NCBI-ProteinID: NP_003113
OMIM: 167790
HGNC: 11244
Ensembl: ENSG00000164266
Vega: OTTHUMG00000129730
Pharos: P00995(Tbio)
UniProt: P00995
Position
5q32
AA seq 79 aa AA seqDB search
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVL
CFENRKRQTSILIQKSGPC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaacaggcatctttcttctcagtgccttggccctgttgagtctatctggtaac
actggagctgactccctgggaagagaggccaaatgttacaatgaacttaatggatgcacc
aagatatatgaccctgtctgtgggactgatggaaatacttatcccaatgaatgcgtgtta
tgttttgaaaatcggaaacgccagacttctatcctcattcaaaaatctgggccttgctga

DBGET integrated database retrieval system