KEGG   Homo sapiens (human): 6693Help
Entry
6693              CDS       T01001                                 

Gene name
SPN, CD43, GALGP, GPL115, LSN
Definition
(RefSeq) sialophorin
  KO
K06477  sialophorin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6693 (SPN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6693 (SPN)
CD molecules [BR:hsa04090]
 Proteins
  6693 (SPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAX LPG_synthase_TM BatA Gemini_mov DUF4381 DUF2681
Motif
Other DBs
NCBI-GeneID: 6693
NCBI-ProteinID: NP_001025459
OMIM: 182160
HGNC: 11249
Ensembl: ENSG00000197471
Vega: OTTHUMG00000097765
Pharos: P16150(Tbio)
UniProt: P16150 A0A024R629
Position
16p11.2
AA seq 400 aa AA seqDB search
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD
QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI
TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK
GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA
STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV
DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE
LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcttctccttctccttggggtgctggtggtaagcccagacgctctggggagc
acaacagcagtgcagacacccacctccggagagcctttggtctctactagcgagcccctg
agctcaaagatgtacaccacttcaataacaagtgaccctaaggccgacagcactggggac
cagacctcagccctacctccctcaacttccatcaatgagggatcccctctttggacttcc
attggtgccagcactggttcccctttacctgagccaacaacctaccaggaagtttccatc
aagatgtcatcagtgccccaggaaacccctcatgcaaccagtcatcctgctgttcccata
acagcaaactctctaggatcccacaccgtgacaggtggaaccataacaacgaactctcca
gaaacctccagtaggaccagtggagcccctgttaccacggcagctagctctctggagacc
tccagaggcacctctggaccccctcttaccatggcaactgtctctctggagacttccaaa
ggcacctctggaccccctgttaccatggcaactgactctctggagacctccactgggacc
actggaccccctgttaccatgacaactggctctctggagccctccagcggggccagtgga
ccccaggtctctagcgtaaaactatctacaatgatgtctccaacgacctccaccaacgca
agcactgtgcccttccggaacccagatgagaactcacgaggcatgctgccagtggctgtg
cttgtggccctgctggcggtcatagtcctcgtggctctgctcctgctgtggcgccggcgg
cagaagcggcggactggggccctcgtgctgagcagaggcggcaagcgtaacggggtggtg
gacgcctgggctgggccagcccaggtccctgaggagggggccgtgacagtgaccgtggga
gggtccgggggcgacaagggctctgggttccccgatggggaggggtctagccgtcggccc
acgctcaccactttctttggcagacggaagtctcgccagggctccctggcgatggaggag
ctgaagtctgggtcaggccccagcctcaaaggggaggaggagccactggtggccagtgag
gatggggctgtggacgccccagctcctgatgagcccgaagggggagacggggctgcccct
taa

DBGET integrated database retrieval system