KEGG   Homo sapiens (human): 6694Help
Entry
6694              CDS       T01001                                 

Gene name
SPP2, SPP-24, SPP24
Definition
(RefSeq) secreted phosphoprotein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Spp-24 Cathelicidins Cystatin
Motif
Other DBs
NCBI-GeneID: 6694
NCBI-ProteinID: NP_008875
OMIM: 602637
HGNC: 11256
Ensembl: ENSG00000072080
Vega: OTTHUMG00000059208
Pharos: Q13103(Tbio)
UniProt: Q13103
Position
2q37.1
AA seq 211 aa AA seqDB search
MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYL
FRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTV
KVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYD
RSLGIMRRVLPPGNRRYPNHRHRARINTDFE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatttccagaatggagaagatgacgatgatgatgaagatattgattatgtttgctctt
ggaatgaactactggtcttgctcaggtttcccagtgtacgactacgatccatcctcctta
agggatgccctcagtgcctctgtggtaaaagtgaattcccagtcactgagtccgtatctg
tttcgggcattcagaagctcattaaaaagagttgaggtcctagatgagaacaacttggtc
atgaatttagagttcagcatccgggagactacatgcaggaaggattctggagaagatccc
gctacatgtgccttccagagggactactatgtgtccacagctgtttgcagaagcaccgtg
aaggtatctgcccagcaggtgcagggcgtgcatgctcgctgcagctggtcctcctccacg
tctgagtcttacagcagcgaagagatgatttttggggacatgttgggatctcataaatgg
agaaacaattatctatttggtctcatttcagacgagtccataagtgaacaattttatgat
cggtcacttgggatcatgagaagggtattgcctcctggaaacagaaggtacccaaaccac
cggcacagagcaagaataaatactgactttgagtaa

DBGET integrated database retrieval system