KEGG   Homo sapiens (human): 6696Help
Entry
6696              CDS       T01001                                 

Gene name
SPP1, BNSP, BSPI, ETA-1, OPN
Definition
(RefSeq) secreted phosphoprotein 1
  KO
K06250  secreted phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6696 (SPP1)
   04151 PI3K-Akt signaling pathway
    6696 (SPP1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6696 (SPP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6696 (SPP1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6696 (SPP1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    6696 (SPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Osteopontin
Motif
Other DBs
NCBI-GeneID: 6696
NCBI-ProteinID: NP_001035147
OMIM: 166490
HGNC: 11255
Ensembl: ENSG00000118785
Vega: OTTHUMG00000130599
Pharos: P10451(Tbio)
UniProt: P10451 A0A024RDE2
Position
4q22.1
AA seq 314 aa AA seqDB search
MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNA
VSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS
DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQ
YPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH
KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
RISHELDSASSEVN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgcagtgatttgcttttgcctcctaggcatcacctgtgccataccagttaaa
caggctgattctggaagttctgaggaaaagcagctttacaacaaatacccagatgctgtg
gccacatggctaaaccctgacccatctcagaagcagaatctcctagccccacagaatgct
gtgtcctctgaagaaaccaatgactttaaacaagagacccttccaagtaagtccaacgaa
agccatgaccacatggatgatatggatgatgaagatgatgatgaccatgtggacagccag
gactccattgactcgaacgactctgatgatgtagatgacactgatgattctcaccagtct
gatgagtctcaccattctgatgaatctgatgaactggtcactgattttcccacggacctg
ccagcaaccgaagttttcactccagttgtccccacagtagacacatatgatggccgaggt
gatagtgtggtttatggactgaggtcaaaatctaagaagtttcgcagacctgacatccag
taccctgatgctacagacgaggacatcacctcacacatggaaagcgaggagttgaatggt
gcatacaaggccatccccgttgcccaggacctgaacgcgccttctgattgggacagccgt
gggaaggacagttatgaaacgagtcagctggatgaccagagtgctgaaacccacagccac
aagcagtccagattatataagcggaaagccaatgatgagagcaatgagcattccgatgtg
attgatagtcaggaactttccaaagtcagccgtgaattccacagccatgaatttcacagc
catgaagatatgctggttgtagaccccaaaagtaaggaagaagataaacacctgaaattt
cgtatttctcatgaattagatagtgcatcttctgaggtcaattaa

DBGET integrated database retrieval system