KEGG   Homo sapiens (human): 6698
Entry
6698              CDS       T01001                                 

Gene name
SPRR1A, SPRK
Definition
(RefSeq) small proline rich protein 1A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cornifin
Other DBs
NCBI-GeneID: 6698
NCBI-ProteinID: NP_001186757
OMIM: 182265
HGNC: 11259
Ensembl: ENSG00000169474
Vega: OTTHUMG00000014404
Pharos: P35321(Tbio)
UniProt: P35321
Position
1q21.3
AA seq 89 aa
MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPK
VPEPCQPKVPEPCPSTVTPAPAQQKTKQK
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaattctcagcagcagaagcagccttgcaccccaccccctcagcctcagcagcagcag
gtgaaacaaccttgccagcctccaccccaggaaccatgcatccccaaaaccaaggagccc
tgccaccccaaggtgcctgagccctgccaccccaaagtgcctgagccctgccagcccaag
gttccagagccctgccagcccaaggtgcctgagccctgcccttcaacggtcactccagca
ccagcccagcagaagaccaagcagaagtaa

DBGET integrated database retrieval system