KEGG   Homo sapiens (human): 6703
Entry
6703              CDS       T01001                                 

Gene name
SPRR2D
Definition
(RefSeq) small proline rich protein 2D
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SPRR2
Other DBs
NCBI-GeneID: 6703
NCBI-ProteinID: NP_008876
OMIM: 617587
HGNC: 11264
Ensembl: ENSG00000163216
Vega: OTTHUMG00000014396
Pharos: P22532(Tdark)
UniProt: P22532
Position
1q21.3
AA seq 72 aa
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS
PPCQPKCPPKSK
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtcttatcaacagcagcagtgcaagcagccctgccagccacctcctgtgtgccccacg
ccaaagtgcccagagccatgtccacccccgaagtgccctgagccctgcccatcaccaaag
tgtccacagccctgcccacctcagcagtgccagcagaaatatcctcctgtgacaccttcc
ccaccctgccagccaaagtgtccacccaagagcaagtaa

DBGET integrated database retrieval system