KEGG   Homo sapiens (human): 6706Help
Entry
6706              CDS       T01001                                 

Gene name
SPRR2G
Definition
(RefSeq) small proline rich protein 2G
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SPRR2
Motif
Other DBs
NCBI-GeneID: 6706
NCBI-ProteinID: NP_001014313
OMIM: 617590
HGNC: 11267
Ensembl: ENSG00000159516
Vega: OTTHUMG00000014399
Pharos: Q9BYE4(Tdark)
UniProt: Q9BYE4
Position
1q21.3
AA seq 73 aa AA seqDB search
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP
YPPCQQKYPPKSK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccagcagcagcagtgcaagcagccctgccagccacctcctgtgtgccccacg
ccaaagtgcccagagccatgtccacccccgaagtgccctgagccttacctgcctcctcct
tgtccacctgagcattgcccacctccaccatgccaggataaatgccctcctgtgcaacca
tacccaccctgccagcagaagtatccacccaagagcaagtaa

DBGET integrated database retrieval system