KEGG   Homo sapiens (human): 671
Entry
671               CDS       T01001                                 

Gene name
BPI, BPIFD1, rBPI
Definition
(RefSeq) bactericidal permeability increasing protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP MatB
Other DBs
NCBI-GeneID: 671
NCBI-ProteinID: NP_001716
OMIM: 109195
HGNC: 1095
Ensembl: ENSG00000101425
Vega: OTTHUMG00000032441
Pharos: P17213(Tbio)
UniProt: P17213
Structure
PDB: 
1EWF 1BP1

Position
20q11.23
AA seq 483 aa
MARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKELKRIK
IPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISGKWKA
QKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKSKVGW
LIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGLVAPP
ATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEA
GVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGL
TFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNI
GPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADV
VYK
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggccaggggcccttgcaacgcgccgagatgggcgtccctgatggtgctggtcgccata
ggcaccgccgtgacagcggccgtcaaccctggcgtcgtggtcaggatctcccagaagggc
ctggactacgccagccagcaggggacggccgctctgcagaaggagctgaagaggatcaag
attcctgactactcagacagctttaagatcaagcatcttgggaaggggcattatagcttc
tacagcatggacatccgtgaattccagcttcccagttcccagataagcatggtgcccaat
gtgggccttaagttctccatcagcaacgccaatatcaagatcagcgggaaatggaaggca
caaaagagattcttaaaaatgagcggcaattttgacctgagcatagaaggcatgtccatt
tcggctgatctgaagctgggcagtaaccccacgtcaggcaagcccaccatcacctgctcc
agctgcagcagccacatcaacagtgtccacgtgcacatctcaaagagcaaagtggggtgg
ctgatccaactcttccacaaaaaaattgagtctgcgcttcgaaacaagatgaacagccag
gtctgcgagaaagtgaccaattctgtatcctccgagctgcaaccttatttccagactctg
ccagtaatgaccaaaatagattctgtggctggaatcaactatggtctggtggcacctcca
gcaaccacggctgagaccctggatgtacagatgaagggggagttttacagtgagaaccac
cacaatccacctccctttgctccaccagtgatggagtttcccgctgcccatgaccgcatg
gtatacctgggcctctcagactacttcttcaacacagccgggcttgtataccaagaggct
ggggtcttgaagatgacccttagagatgacatgattccaaaggagtccaaatttcgactg
acaaccaagttctttggaaccttcctacctgaggtggccaagaagtttcccaacatgaag
atacagatccatgtctcagcctccaccccgccacacctgtctgtgcagcccaccggcctt
accttctaccctgccgtggatgtccaggcctttgccgtcctccccaactcctccctggct
tccctcttcctgattggcatgcacacaactggttccatggaggtcagcgccgagtccaac
aggcttgttggagagctcaagctggataggctgctcctggaactgaagcactcaaatatt
ggccccttcccggttgaattgctgcaggatatcatgaactacattgtacccattcttgtg
ctgcccagggttaacgagaaactacagaaaggcttccctctcccgacgccggccagagtc
cagctctacaacgtagtgcttcagcctcaccagaacttcctgctgttcggtgcagacgtt
gtctataaatga

DBGET integrated database retrieval system