KEGG   Homo sapiens (human): 6713Help
Entry
6713              CDS       T01001                                 

Gene name
SQLE
Definition
(RefSeq) squalene epoxidase
  KO
K00511  squalene monooxygenase [EC:1.14.14.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    6713 (SQLE)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.17  squalene monooxygenase
     6713 (SQLE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SE FAD_binding_3 DAO NAD_binding_8 FAD_binding_2 Pyr_redox TrkA_N Trp_halogenase Shikimate_DH Pyr_redox_2 3HCDH_N ApbA Thi4 NAD_Gly3P_dh_N Sacchrp_dh_NADP NAD_binding_2 GIDA AlaDh_PNT_C F420_oxidored CBP_BcsF
Motif
Other DBs
NCBI-GeneID: 6713
NCBI-ProteinID: NP_003120
OMIM: 602019
HGNC: 11279
Ensembl: ENSG00000104549
Vega: OTTHUMG00000164990
Pharos: Q14534(Tchem)
UniProt: Q14534 Q5HYI4
Structure
PDB: 

Position
8q24.13
AA seq 574 aa AA seqDB search
MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSG
SQFALFSDILSGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSS
QNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL
GDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAE
PNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKV
SVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYM
VEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGG
MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSAT
DDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPW
ITKPRALLSSGAVLYKACSVIFPLIYSEMKYMVH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttttctgggcattgccactttcacctatttttataagaagttcggggacttc
atcactttggccaacagggaggtcctgttgtgcgtgctggtgttcctctcgctgggcctg
gtgctctcctaccgctgtcgccaccgaaacgggggtctcctcgggcgccagcagagcggc
tcccagttcgccctcttctcggatattctctcaggcctgcctttcattggcttcttctgg
gccaaatccccccctgaatcagaaaataaggagcagctcgaggccaggaggcgcagaaaa
ggaaccaatatttcagaaacaagcttaataggaacagctgcctgtacatcaacatcttct
cagaatgacccagaagttatcatcgtgggagctggcgtgcttggctctgctttggcagct
gtgctttccagagatggaagaaaggtgacagtcattgagagagacttaaaagagcctgac
agaatagttggagaattcctgcagccgggtggttatcatgttctcaaagaccttggtctt
ggagatacagtggaaggtcttgatgcccaggttgtaaatggttacatgattcatgatcag
gaaagcaaatcagaggttcagattccttaccctctgtcagaaaacaatcaagtgcagagt
ggaagagctttccatcacggaagattcatcatgagtctccggaaagcagctatggcagag
cccaatgcaaagtttattgaaggtgttgtgttacagttattagaggaagatgatgttgtg
atgggagttcagtacaaggataaagagactggagatatcaaggaactccatgctccactg
actgttgttgcagatgggcttttctccaagttcaggaaaagcctggtctccaataaagtt
tctgtatcatctcattttgttggctttcttatgaagaatgcaccacagtttaaagcaaat
catgctgaacttattttagctaacccgagtccagttctcatctaccagatttcatccagt
gaaactcgagtacttgttgacattagaggagaaatgccaaggaatttaagagaatacatg
gttgaaaaaatttacccacaaatacctgatcacctgaaagaaccattcttagaagccact
gacaattctcatctgaggtccatgccagcaagcttccttcctccttcatcagtgaagaaa
cgaggtgttcttcttttgggagacgcatataatatgaggcatccacttactggtggagga
atgactgttgcttttaaagatataaaactatggagaaaactgctaaagggtatccctgac
ctttatgatgatgcagctattttcgaggccaaaaaatcattttactgggcaagaaaaaca
tctcattcctttgtcgtgaatatccttgctcaggctctttatgaattattttctgccaca
gatgattccctgcatcaactaagaaaagcctgttttctttatttcaaacttggtggcgaa
tgtgttgcgggtcctgttgggctgctttctgtattgtctcctaaccctctagttttaatt
ggacacttctttgctgttgcaatctatgccgtgtatttttgctttaagtcagaaccttgg
attacaaaacctcgagcccttctcagtagtggtgctgtattgtacaaagcgtgttctgta
atatttcctctaatttactcagaaatgaagtatatggttcattaa

DBGET integrated database retrieval system