KEGG   Homo sapiens (human): 6715Help
Entry
6715              CDS       T01001                                 

Gene name
SRD5A1, S5AR_1
Definition
(RefSeq) steroid 5 alpha-reductase 1
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
Drug target
Alfatradiol: D07121
Bexlosteride: D03107
Dutasteride: D03820
Epristeride: D01134
Idronoxil: D04498
Izonsteride: D04646
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    6715 (SRD5A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6715 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 6715
NCBI-ProteinID: NP_001038
OMIM: 184753
HGNC: 11284
Ensembl: ENSG00000145545
Vega: OTTHUMG00000090456
Pharos: P18405(Tclin)
UniProt: P18405
Position
5p15.31
AA seq 259 aa AA seqDB search
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcgacgggggtggcggaggagcgcctgctggccgcgctcgcctacctgcag
tgcgccgtgggctgcgcggtcttcgcgcgcaatcgtcagacgaactcagtgtacggccgc
cacgcgctgcccagccacaggctccgagtgccggcgcgggccgcctgggtggtgcaggag
ctgccctcgctggccctgccgctctaccagtacgccagcgagtccgccccgcgtctccgc
agcgcgcccaactgcatcctcctggccatgttcctcgtccactacgggcatcggtgctta
atttacccatttctgatgcgaggaggaaagcctatgccactgttggcgtgtacaatggcg
attatgttctgtacctgtaacggctatttgcaaagcagatacttgagccattgtgcagtg
tatgctgatgactgggtaacagatccccgttttctaataggttttggcttgtggttaacg
ggcatgttgataaacatccattcagatcatatcctaaggaatctcagaaaaccaggagat
actggatacaaaataccaaggggaggcttatttgaatacgtaactgcagccaactatttt
ggagaaatcatggagtggtgtggctatgccctggccagctggtctgtccaaggcgcggct
tttgctttcttcacgttttgttttttatctggtagagcaaaagagcatcatgagtggtac
ctccggaaatttgaagagtatccaaagttcagaaaaattataattccatttttgttttaa

DBGET integrated database retrieval system