KEGG   Homo sapiens (human): 6716
Entry
6716              CDS       T01001                                 

Symbol
SRD5A2
Name
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa05215  Prostate cancer
Disease
H00608  46,XY disorder of sex development due to testosterone secretion defect
Drug target
Alfatradiol: D07121
Dutasteride: D03820<JP/US>
Epristeride: D01134
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Finasteride: D00321<JP/US>
Idronoxil: D04498
Izonsteride: D04646
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    6716 (SRD5A2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    6716 (SRD5A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6716 (SRD5A2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 6716
NCBI-ProteinID: NP_000339
OMIM: 607306
HGNC: 11285
Ensembl: ENSG00000277893
Vega: OTTHUMG00000152057
Pharos: P31213(Tclin)
UniProt: P31213
Position
2p23.1
AA seq 254 aa
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcctg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcctacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcactgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system