KEGG   Homo sapiens (human): 6716Help
Entry
6716              CDS       T01001                                 

Gene name
SRD5A2
Definition
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa05215  Prostate cancer
Disease
H00608  46,XY disorder of sex development due to testosterone secretion defect
Drug target
Alfatradiol: D07121
Dutasteride: D03820
Epristeride: D01134
Estramustine (DG00724): D02398 D04066 D06397
Finasteride: D00321
Idronoxil: D04498
Izonsteride: D04646
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    6716 (SRD5A2)
 09160 Human Diseases
  09162 Cancers: Specific types
   05215 Prostate cancer
    6716 (SRD5A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     6716 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 6716
NCBI-ProteinID: NP_000339
OMIM: 607306
HGNC: 11285
Ensembl: ENSG00000277893
Vega: OTTHUMG00000152057
Pharos: P31213(Tclin)
UniProt: P31213
Position
2p23.1
AA seq 254 aa AA seqDB search
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcctg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcctacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcactgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system