KEGG   Homo sapiens (human): 6721
Entry
6721              CDS       T01001                                 

Gene name
SREBF2, SREBP-2, SREBP2, bHLHd2
Definition
(RefSeq) sterol regulatory element binding transcription factor 2
  KO
K09107  sterol regulatory element-binding transcription factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6721 (SREBF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    6721 (SREBF2)
SSDB
Motif
Pfam: HLH BCAS2
Other DBs
NCBI-GeneID: 6721
NCBI-ProteinID: NP_004590
OMIM: 600481
HGNC: 11290
Ensembl: ENSG00000198911
Vega: OTTHUMG00000151261
Pharos: Q12772(Tchem)
UniProt: Q12772 A0A024R1Q0
Structure
PDB: 
1UKL

Position
22q13.2
AA seq 1141 aa
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS
VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV
LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP
VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT
DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS
RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL
LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK
TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA
AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA
AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG
ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR
LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER
ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA
S
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggacgacagcggcgagctgggtggtctggagaccatggagaccctcacggagctgggc
gacgagctgaccctgggagacatcgacgagatgctgcaatttgtcagtaatcaagtggga
gagttccctgacttgttttcagaacagctgtgtagctcctttcctggcagtggtggtagt
ggtagcagcagcggcagcagtggcagcagcagcagcagcagcaatggcaggggcagcagc
agcggagctgtggacccttcagtgcaacggtcattcacccaggtcacattaccttccttc
tctccctcggcggcctccccacaggctccaactctgcaagtcaaggtttctcccacctca
gttcccaccacacccagggcaactcctattcttcagccccgcccccagccccagcctcaa
cctcaaactcagctgcaacaacagacggtaatgatcacgccaacattcagcaccactccg
cagacgaggatcatccagcagcctttgatataccagaatgcagctactagctttcaagtc
cttcagcctcaagtccaaagcctggtgacatcctcccaggtacagccggtcaccattcag
cagcaggtgcagacagtacaggcccagcgggtgctgacacaaacggccaatggcacgctg
cagacccttgccccggctacggtgcagacagttgctgcgccacaggtgcagcaggtcccg
gtcctggtccagcctcagatcatcaagacagattcccttgttttgaccacactgaagaca
gatggcagccctgttatggctgcggtccagaacccggccctcaccgccctcaccacccct
atccagacggctgcccttcaagtaccaaccctggtgggcagcagtgggaccattctgacc
acaatgcctgtaatgatggggcaagagaaagtgcccattaagcaggtacctgggggagtc
aagcagcttgagccccccaaagaaggagaaaggcggacaacccataatatcattgagaaa
cgatatcgctcctccatcaatgacaaaatcatcgaattgaaagacctggtcatggggaca
gacgccaagatgcacaagtctggcgttctgaggaaggccattgattacatcaaatacttg
cagcaggtcaatcataaactgcgccaggagaacatggtgctgaagctggcaaatcaaaag
aacaagcttctaaagggcatcgacctaggcagtctggtggacaatgaggtggacctgaag
atcgaggactttaatcagaatgtccttctgatgtcccccccagcctctgactcagggtcc
caggctggcttctctccctactccattgactctgagccaggaagccctctattggatgat
gcaaaggtcaaagatgagccagactctcctcctgtggcgctgggcatggtagaccgctca
cggattcttctgtgtgtcctcaccttcctgtgcctctcctttaaccccctgacttccctg
ctgcagtggggaggggcccacgactctgaccagcacccacactcaggctctggccgcagt
gtcctgtcattcgagtcaggttctgggggctggtttgactggatgatgcctactcttctc
ttatggctggtaaatggtgtgattgtcctgagcgtctttgtgaagctgctggttcatggg
gagccagtgatccggccacactcgcgctcctcggtcaccttctggaggcaccggaaacag
gcagatctggatctcgccagaggagattttgcagctgctgccggcaacctacaaacctgc
ctggcagttttgggccgggcactgcccacctcccgcctggacctggcctgcagcctctcc
tggaacgtgatccgctacagcctgcagaagctacgcctggtgcgctggctgctcaagaaa
gtcttccagtgccggcgggccacgccagccactgaggcaggctttgaagacgaagctaag
accagcgcccgggatgcggctctggcctatcaccggctgcaccagctgcacatcacaggg
aagcttcctgcaggatccgcctgttccgatgtacacatggcgttgtgtgccgtgaacctg
gctgaatgtgcagaggagaagatcccaccgagcacactggttgagatccatctgactgct
gccatggggctcaagacccggtgtggaggcaagctgggcttcctggccagctacttcctc
agccgagcccagagcctgtgtggccccgagcacagtgctgttcctgactccctgcgctgg
ctctgccaccccctgggccagaagtttttcatggagcggagctggtctgtgaagtcagct
gccaaggagagtctatactgtgcccagaggaacccagctgaccccattgcgcaggtccac
caggccttctgcaagaacctgctggagcgagctatagagtccttggtgaaacctcaggcc
aagaagaaggctggagaccaggaagaagagagctgtgaattctccagtgctctggagtac
ttgaaattacttcattcttttgtggactctgtgggggttatgagccccccactctccagg
agctccgtgctcaagtccgccctgggtccagacatcatctgtcggtggtggacgtctgca
atcactgtggccatcagctggctccagggagacgatgcagctgtgcgctctcattttacc
aaagtggaacgcatccccaaggccctggaagtgacagagagccccctggtgaaggccatc
ttccatgcctgcagagccatgcatgcctcactccctgggaaagcagatgggcagcagagt
tccttctgccattgcgagagggccagtggccacctatggagcagcctcaacgtcagtggg
gccacctctgaccctgccctcaaccacgtggtccagctgctcacctgtgacctgctactg
tcgctacggacagcgctctggcaaaaacaggccagtgccagccaggctgtgggggagacc
taccacgcgtcaggcgctgaactggcgggcttccaacgggacctgggcagcctgcgcagg
ctggcacacagcttccgcccagcataccgcaaggtgttcctgcatgaagccaccgtgcgc
ctgatggcaggagccagccccacccgcacccaccagctgctggaacacagcctgcggcgg
cgcaccacgcagagcaccaagcacggagaggtggatgcctggcccggccagcgagagcgg
gccaccgccatcctgctggcctgccgccacctgcccctctccttcctctcctccccgggc
cagcgggcagtgctgctggccgaagctgcccgcaccctggagaaggtgggcgaccggcgc
tcctgcaacgactgccagcagatgattgttaagctgggtggtggcactgccattgccgcc
tcctga

DBGET integrated database retrieval system