KEGG   Homo sapiens (human): 6722Help
Entry
6722              CDS       T01001                                 

Gene name
SRF, MCM1
Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
N00221  HTLV-1 Tax to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6722 (SRF)
   04022 cGMP-PKG signaling pathway
    6722 (SRF)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    6722 (SRF)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    6722 (SRF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6722 (SRF)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    6722 (SRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF
Motif
Other DBs
NCBI-GeneID: 6722
NCBI-ProteinID: NP_003122
OMIM: 600589
HGNC: 11291
Ensembl: ENSG00000112658
Vega: OTTHUMG00000014722
Pharos: P11831(Tbio)
UniProt: P11831 A0A024RD16
Structure
PDB: 

Position
6p21.1
AA seq 508 aa AA seqDB search
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgacccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggcggcggcggcgggacacgcggggctaac
gggggccgggtccccgggaatggcgcggggctcgggcccggccgcctggagcgggaggct
gcggcagcggcggcaaccaccccggcgcccaccgcgggggccctctacagcggcagcgag
ggcgactcggagtcgggcgaggaggaggagctgggcgccgagcggcgcggcctgaagcgg
agcctgagcgagatggagatcggtatggtggtcggtgggcccgaggcgtcggcagcggcc
accgggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaagacc
cggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacgacc
ttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgccacccga
aaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgttcagaccccacaacagaccagagaatgagtgccactggc
tttgaagagacagatctcacctaccaggtgtcggagtctgacagcagtggggagaccaag
gacacactgaagccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaa
acagcacctagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatcacc
aactacctggcaccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatggg
actgtgctgaagagtacaggcagcggccctgtctcctctgggggccttatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caagtgcaccaggccccacagcaagcgtctccctcccgtgacagcagcacagacctcacg
cagacctcctccagcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgccc
acaactgtgggtggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacc
tcgggcctgggtgatggcagcctcaccgtgctgaatgccttctcccaggcaccatccacc
atgcaggtgtcacacagccaggtccaggagccaggtggcgtcccccaggtgttcctgaca
gcatcatctgggacagtgcagatccctgtttcagcagttcagctccaccagatggctgtg
atagggcagcaggccgggagcagcagcaacctcaccgagctacaggtggtgaacctggac
accgcccacagcaccaagagtgaatga

DBGET integrated database retrieval system