KEGG   Homo sapiens (human): 6723Help
Entry
6723              CDS       T01001                                 

Gene name
SRM, PAPT, SPDSY, SPS1, SRML1
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00330  Arginine and proline metabolism
hsa00410  beta-Alanine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Module
hsa_M00034  Methionine salvage pathway
hsa_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    6723 (SRM)
   00330 Arginine and proline metabolism
    6723 (SRM)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    6723 (SRM)
   00480 Glutathione metabolism
    6723 (SRM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     6723 (SRM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25 Methyltransf_30
Motif
Other DBs
NCBI-GeneID: 6723
NCBI-ProteinID: NP_003123
OMIM: 182891
HGNC: 11296
Ensembl: ENSG00000116649
Vega: OTTHUMG00000002119
Pharos: P19623(Tchem)
UniProt: P19623
Structure
PDB: 

Position
1p36.22
AA seq 302 aa AA seqDB search
MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYG
NVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESV
VQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGP
AESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPT
YPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND
VS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggccccgacggccccgccgcctccggccccgccgccatccgcgagggctgg
ttccgcgagacctgcagcctgtggcccggccaggccctgtcactgcaggtggagcagctg
ctccaccaccggcgctcgcgctaccaggacatcctcgtcttccgcagtaagacctatggc
aacgtgctggtgttggacggtgtcatccagtgcacggagagagacgagttctcctaccag
gagatgatcgccaacctgcctctctgcagccaccccaacccgcgaaaggtgctgatcatc
gggggcggagatggaggtgtcctgcgggaggtggtgaagcacccctccgtggagtccgtg
gtccagtgtgagatcgacgaggatgtcatccaagtctccaagaagttcctgccaggcatg
gccattggctactctagctcgaagctgaccctacatgtgggtgacggttttgagttcatg
aaacagaatcaggatgccttcgacgtgatcatcactgactcctcagaccccatgggcccc
gccgaaagtctcttcaaggagtcctattaccagctcatgaagacagccctcaaggaagat
ggtgtcctctgctgccagggcgagtgccagtggctgcacctggacctcatcaaggagatg
cggcagttctgccagtccctgttccccgtggtggcctatgcctactgcaccatccccacc
taccccagcggccagatcggcttcatgctgtgcagcaagaacccgagcacgaacttccag
gagccggtgcagccgctgacacagcagcaggtggcgcagatgcagctgaagtactacaac
tccgacgtgcaccgcgccgcctttgtgctgcccgagtttgcccgcaaggccctgaatgat
gtgagctga

DBGET integrated database retrieval system