KEGG   Homo sapiens (human): 6727Help
Entry
6727              CDS       T01001                                 

Gene name
SRP14, ALURBP
Definition
(RefSeq) signal recognition particle 14
  KO
K03104  signal recognition particle subunit SRP14
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    6727 (SRP14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    6727 (SRP14)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6727 (SRP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRP14 Cdh1_DBD_1
Motif
Other DBs
NCBI-GeneID: 6727
NCBI-ProteinID: NP_003125
OMIM: 600708
HGNC: 11299
Ensembl: ENSG00000140319
Vega: OTTHUMG00000172391
Pharos: P37108(Tbio)
UniProt: P37108
Structure
PDB: 

Position
15q15.1
AA seq 136 aa AA seqDB search
MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRA
TDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAA
ATAPTTAATTAATAAQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgttggagagcgagcagttcctgacggagctgaccagacttttccagaagtgc
cggacgtcgggcagcgtctatatcaccttgaagaagtatgacggtcgaaccaaacccatt
ccaaagaagggtactgtggagggctttgagcccgcagacaacaagtgtctgttaagagct
accgatgggaagaagaagatcagcactgtggtgagctccaaggaagtgaataagtttcag
atggcttattcaaacctccttagagctaacatggatgggctgaagaagagagacaaaaag
aacaaaactaagaagaccaaagcagcagcagcagcagcagcagcagcacctgccgcagca
gcaacagcaccaacaacagcagcaacaacagcagcaacagcagcacagtaa

DBGET integrated database retrieval system