KEGG   Homo sapiens (human): 6729Help
Entry
6729              CDS       T01001                                 

Gene name
SRP54
Definition
(RefSeq) signal recognition particle 54
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    6729 (SRP54)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    6729 (SRP54)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     6729 (SRP54)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   6729 (SRP54)
  Eukaryotic Sec-SRP protein
   6729 (SRP54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRP54 SRP_SPB SRP54_N cobW AAA_33 CbiA DUF2209 SRPRB MeaB AAA_17 CLP1_P ResIII AAA_30 AAA_22 MMR_HSR1 APS_kinase AAA_16 AAA_31 6PF2K MobB AAA_18 AAA_28 Thymidylate_kin ATP_bind_1 AAA G-alpha Zeta_toxin AAA_19 Torsin ArsA_ATPase
Motif
Other DBs
NCBI-GeneID: 6729
NCBI-ProteinID: NP_003127
OMIM: 604857
HGNC: 11301
Ensembl: ENSG00000100883
Vega: OTTHUMG00000140214
Pharos: P61011(Tbio)
UniProt: P61011
Structure
PDB: 

Position
14q13.2
AA seq 504 aa AA seqDB search
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK
NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV
DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGL
QSMMRQFQQGAAGNMKGMMGFNNM
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggttctagcagaccttggaagaaaaataacatcagcattacgctcgttgagcaatgcc
accattatcaatgaagaggtattgaatgctatgctaaaagaagtctgtaccgctttgttg
gaagcagatgttaatattaaactagtgaagcaactaagagaaaatgttaagtctgctatt
gatcttgaagagatggcatctggtcttaacaaaagaaaaatgattcagcatgctgtattt
aaagaacttgtgaagcttgtagaccctggagttaaggcatggacacccactaaaggaaaa
caaaatgtgattatgtttgttggattgcaagggagtggtaaaacaacaacatgttcaaag
ctagcatattattaccagaggaaaggttggaagacctgtttaatatgtgcagacacattc
agagcaggggcttttgaccaactaaaacagaatgctaccaaagcaagaattccattttat
ggaagctatacagaaatggatcctgtcatcattgcttctgaaggagtagagaaatttaaa
aatgaaaattttgaaattattattgttgatacaagtggccgccacaaacaagaagactct
ttgtttgaagaaatgcttcaagttgctaatgctatacaacctgataacattgtttatgtg
atggatgcctccattgggcaggcttgtgaagcccaggctaaggcttttaaagataaagta
gatgtagcctcagtaatagtgacaaaacttgatggccatgcaaaaggaggtggtgcactc
agtgcagtcgctgccacaaaaagtccgattattttcattggtacaggggaacatatagat
gactttgaacctttcaaaacacagccttttattagcaaacttcttggtatgggcgacatt
gaaggactgatagataaagtcaacgagttgaagttggatgacaatgaagcacttatagag
aagttgaaacatggtcagtttacgttgcgagacatgtatgagcaatttcaaaatatcatg
aaaatgggccccttcagtcagatcttggggatgatccctggttttgggacagattttatg
agcaaaggaaatgaacaggagtcaatggcaaggctaaagaaattaatgacaataatggat
agtatgaatgatcaagaactagacagtacggatggtgccaaagtttttagtaaacaacca
ggaagaatccaaagagtagcaagaggatcgggtgtatcaacaagagatgttcaagaactt
ttgacacaatataccaagtttgcacagatggtaaaaaagatgggaggtatcaaaggactt
ttcaaaggtggcgacatgtctaagaatgtgagccagtcacagatggcaaaattgaaccaa
caaatggccaaaatgatggatcctagggttcttcatcacatgggtggtatggcaggactt
cagtcaatgatgaggcagtttcaacagggtgctgctggcaacatgaaaggcatgatggga
ttcaataatatgtaa

DBGET integrated database retrieval system