KEGG   Homo sapiens (human): 6733Help
Entry
6733              CDS       T01001                                 

Gene name
SRPK2, SFRSK2
Definition
(RefSeq) SRSF protein kinase 2
  KO
K08831  serine/threonine-protein kinase SRPK2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6733 (SRPK2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6733 (SRPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6733 (SRPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   6733 (SRPK2)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    6733 (SRPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 6733
NCBI-ProteinID: NP_001265202
OMIM: 602980
HGNC: 11306
Ensembl: ENSG00000135250
Vega: OTTHUMG00000157405
Pharos: P78362(Tbio)
UniProt: P78362 A0A024R704
Structure
PDB: 

Position
7q22.3
AA seq 688 aa AA seqDB search
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDP
ADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTE
TALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQ
KAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIE
KDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQ
EESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKH
FTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIA
HIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFT
DFLIPMLEMVPEKRASAGECLRHPWLNS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaactctgagaagtcgtcctcttcagaaaggccggagcctcaacagaaagct
cctttagttcctcctcctccaccgccaccaccaccaccaccgccacctttgccagacccc
acacccccggagccagaggaggagatcctgggatcagatgatgaggagcaagaggaccct
gcggactactgcaaaggtggatatcatccagtgaaaattggagacctcttcaatggccgg
tatcatgttattagaaagcttggatgggggcacttctctactgtctggctgtgctgggat
atgcaggggaaaagatttgttgcaatgaaagttgtaaaaagtgcccagcattatacggag
acagccttggatgaaataaaattgctcaaatgtgttcgagaaagtgatcccagtgaccca
aacaaagacatggtggtccagctcattgacgacttcaagatttcaggcatgaatgggata
catgtctgcatggtcttcgaagtacttggccaccatctcctcaagtggatcatcaaatcc
aactatcaaggcctcccagtacgttgtgtgaagagtatcattcgacaggtccttcaaggg
ttagattacttacacagtaagtgcaagatcattcatactgacataaagccggaaaatatc
ttgatgtgtgtggatgatgcatatgtgagaagaatggcagctgaggccactgagtggcag
aaagcaggtgctcctcctccttcagggtctgcagtgagtacggctccacagcagaaacct
ataggaaaaatatctaaaaacaaaaagaaaaaactgaaaaagaaacagaagaggcaggct
gagttattggagaagcgcctgcaggagatagaagaattggagcgagaagctgaaaggaaa
ataatagaagaaaacatcacctcagctgcaccttccaatgaccaggatggcgaatactgc
ccagaggtgaaactaaaaacaacaggattagaggaggcggctgaggcagagactgcaaag
gacaatggtgaagctgaggaccaggaagagaaagaagatgctgagaaagaaaacattgaa
aaagatgaagatgatgtagatcaggaacttgcgaacatagaccctacgtggatagaatca
cctaaaaccaatggccatattgagaatggcccattctcactggagcagcaactggacgat
gaagatgatgatgaagaagactgcccaaatcctgaggaatataatcttgatgagccaaat
gcagaaagtgattacacatatagcagctcctatgaacaattcaatggtgaattgccaaat
ggacgacataaaattcccgagtcacagttcccagagttttccacctcgttgttctctgga
tccttagaacctgtggcctgcggctctgtgctttctgagggatcaccacttactgagcaa
gaggagagcagtccatcccatgacagaagcagaacggtttcagcctccagtactggggat
ttgccaaaagcaaaaacccgggcagctgacttgttggtgaatcccctggatccgcggaat
gcagataaaattagagtaaaaattgctgacctgggaaatgcttgttgggtgcataaacac
ttcacggaagacatccagacgcgtcagtaccgctccatagaggttttaataggagcgggg
tacagcacccctgcggacatctggagcacggcgtgtatggcatttgagctggcaacggga
gattatttgtttgaaccacattctggggaagactattccagagacgaagaccacatagcc
cacatcatagagctgctaggcagtattccaaggcactttgctctatctggaaaatattct
cgggaattcttcaatcgcagaggagaactgcgacacatcaccaagctgaagccctggagc
ctctttgatgtacttgtggaaaagtatggctggccccatgaagatgctgcacagtttaca
gatttcctgatcccgatgttagaaatggttccagaaaaacgagcctcagctggcgaatgc
cttcggcatccttggttgaattcttag

DBGET integrated database retrieval system