KEGG   Homo sapiens (human): 6736Help
Entry
6736              CDS       T01001                                 

Gene name
SRY, SRXX1, SRXY1, TDF, TDY
Definition
(RefSeq) sex determining region Y
  KO
K09266  sex-determining region Y protein (SOX group A)
Organism
hsa  Homo sapiens (human)
Disease
H00598  46,XX testicular disorder of sex development
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6736 (SRY)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    6736 (SRY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 DUF1908
Motif
Other DBs
NCBI-GeneID: 6736
NCBI-ProteinID: NP_003131
OMIM: 480000
HGNC: 11311
Ensembl: ENSG00000184895
Vega: OTTHUMG00000036084
Pharos: Q05066(Tbio)
UniProt: Q05066 A7WPU8
Structure
PDB: 

Position
Yp11.2
AA seq 204 aa AA seqDB search
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatatgcttctgctatgttaagcgtattcaacagcgatgattacagtccagct
gtgcaagagaatattcccgctctccggagaagctcttccttcctttgcactgaaagctgt
aactctaagtatcagtgtgaaacgggagaaaacagtaaaggcaacgtccaggatagagtg
aagcgacccatgaacgcattcatcgtgtggtctcgcgatcagaggcgcaagatggctcta
gagaatcccagaatgcgaaactcagagatcagcaagcagctgggataccagtggaaaatg
cttactgaagccgaaaaatggccattcttccaggaggcacagaaattacaggccatgcac
agagagaaatacccgaattataagtatcgacctcgtcggaaggcgaagatgctgccgaag
aattgcagtttgcttcccgcagatcccgcttcggtactctgcagcgaagtgcaactggac
aacaggttgtacagggatgactgtacgaaagccacacactcaagaatggagcaccagcta
ggccacttaccgcccatcaacgcagccagctcaccgcagcaacgggaccgctacagccac
tggacaaagctgtag

DBGET integrated database retrieval system