KEGG   Homo sapiens (human): 6738Help
Entry
6738              CDS       T01001                                 

Gene name
RO60, RORNP, SSA2, TROVE2
Definition
(RefSeq) Ro60, Y RNA binding protein
  KO
K11089  60 kDa SS-A/Ro ribonucleoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6738 (RO60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TROVE DUF2201 VWA_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 6738
NCBI-ProteinID: NP_001166995
OMIM: 600063
HGNC: 11313
Ensembl: ENSG00000116747
Vega: OTTHUMG00000035675
Pharos: P10155(Tbio)
UniProt: P10155 A0A024R983
Position
1q31.2
AA seq 538 aa AA seqDB search
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRD
ELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKT
FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPA
IALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatctgtaaaccaaatgcagccactgaatgagaagcagatagccaattctcag
gatggatatgtatggcaagtcactgacatgaatcgactacaccggttcttatgtttcggt
tctgaaggtgggacttattatatcaaagaacagaagttgggccttgaaaatgctgaagct
ttaattagattgattgaagatggcagaggatgtgaagtgatacaagaaataaagtcattt
agtcaagaaggcagaaccacaaagcaagagcctatgctctttgcacttgccatttgttcc
cagtgctccgacataagcacaaaacaagcagcatttaaagctgtttctgaagtttgtcgc
attcctacccatctctttacttttatccagtttaagaaagatctgaaggaaagcatgaaa
tgtggcatgtggggtcgtgccctccggaaggctatagcggactggtacaatgagaaaggt
ggcatggcccttgctctggcagttacaaaatataaacagagaaatggctggtctcacaaa
gatctattaagattgtcacatcttaaaccttccagtgaaggacttgcaattgtgaccaaa
tatattacaaagggctggaaagaagttcatgaattgtataaagaaaaagcactctctgtg
gagactgaaaaattattaaagtatctggaggctgtagagaaagtgaagcgcacaagagat
gagctagaagtcattcatctaatagaagaacatagattagttagagaacatcttttaaca
aatcacttaaagtctaaagaggtatggaaggctttgttacaagaaatgccgcttactgca
ttactaaggaatctaggaaagatgactgctaattcagtacttgaaccaggaaattcagaa
gtatctttagtatgtgaaaaactgtgtaatgaaaaactattaaaaaaggctcgtatacat
ccatttcatattttgatcgcattagaaacttacaagacaggtcatggtctcagagggaaa
ctgaagtggcgccctgatgaagaaattttgaaagcattggatgctgctttttataaaaca
tttaagacagttgaaccaactggaaaacgtttcttactagctgttgatgtcagtgcttct
atgaaccaaagagttttgggtagtatactcaacgctagtacagttgctgcagcaatgtgc
atggttgtcacacgaacagaaaaagattcttatgtagttgctttttccgatgaaatggta
ccatgtccagtgactacagatatgaccttacaacaggttttaatggctatgagtcagatc
ccagcaggtggaactgattgctctcttccaatgatctgggctcagaagacaaacacacct
gctgatgtcttcattgtattcactgataatgagacctttgctggaggtgtccatcctgct
attgctctgagggagtatcgaaagaaaatggatattccagctaaattgattgtttgtgga
atgacatcaaatggtttcaccattgcagacccagatgatagaggcatgttggatatgtgc
ggctttgatactggagctctggatgtaattcgaaatttcacattagatatgatttaa

DBGET integrated database retrieval system