KEGG   Homo sapiens (human): 6741Help
Entry
6741              CDS       T01001                                 

Gene name
SSB, LARP3, La, La/SSB
Definition
(RefSeq) Sjogren syndrome antigen B
  KO
K11090  lupus La protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    6741 (SSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_3 La RRM_1
Motif
Other DBs
NCBI-GeneID: 6741
NCBI-ProteinID: NP_001281074
OMIM: 109090
HGNC: 11316
Ensembl: ENSG00000138385
Vega: OTTHUMG00000132212
Pharos: P05455(Tbio)
UniProt: P05455
Structure
PDB: 

Position
2q31.1
AA seq 408 aa AA seqDB search
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNR
LTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDL
LILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDL
DDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE
VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGK
KTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatggtgataatgaaaagatggctgccctggaggccaaaatctgtcatcaa
attgagtattattttggcgacttcaatttgccacgggacaagtttctaaaggaacagata
aaactggatgaaggctgggtacctttggagataatgataaaattcaacaggttgaaccgt
ctaacaacagactttaatgtaattgtggaagcattgagcaaatccaaggcagaactcatg
gaaatcagtgaagataaaactaaaatcagaaggtctccaagcaaacccctacctgaagtg
actgatgagtataaaaatgatgtaaaaaacagatctgtttatattaaaggcttcccaact
gatgcaactcttgatgacataaaagaatggttagaagataaaggtcaagtactaaatatt
cagatgagaagaacattgcataaagcatttaagggatcaatttttgttgtgtttgatagc
attgaatctgctaagaaatttgtagagacccctggccagaagtacaaagaaacagacctg
ctaatacttttcaaggacgattactttgccaaaaaaaatgaagaaagaaaacaaaataaa
gtggaagctaaattaagagctaaacaggagcaagaagcaaaacaaaagttagaagaagat
gctgaaatgaaatctctagaagaaaagattggatgcttgctgaaattttcgggtgattta
gatgatcagacctgtagagaagatttacacatacttttctcaaatcatggtgaaataaaa
tggatagacttcgtcagaggagcaaaagaggggataattctatttaaagaaaaagccaag
gaagcattgggtaaagccaaagatgcaaataatggtaacctacaattaaggaacaaagaa
gtgacttgggaagtactagaaggagaggtggaaaaagaagcactgaagaaaataatagaa
gaccaacaagaatccctaaacaaatggaagtcaaaaggtcgtagatttaaaggaaaagga
aagggtaataaagctgcccagcctgggtctggtaaaggaaaagtacagtttcagggcaag
aaaacgaaatttgctagtgatgatgaacatgatgaacatgatgaaaatggtgcaactgga
cctgtgaaaagagcaagagaagaaacagacaaagaagaacctgcatccaaacaacagaaa
acagaaaatggtgctggagaccagtag

DBGET integrated database retrieval system