KEGG   Homo sapiens (human): 6744
Entry
6744              CDS       T01001                                 

Gene name
ITPRID2, CS-1, CS1, KRAP, SPAG13, SSFA2
Definition
(RefSeq) ITPR interacting domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SSFA2_C KRAP_IP3R_bind
Other DBs
NCBI-GeneID: 6744
NCBI-ProteinID: NP_001123917
OMIM: 118990
HGNC: 11319
Ensembl: ENSG00000138434
Vega: OTTHUMG00000132584
Pharos: P28290(Tbio)
UniProt: P28290
Position
2q31.3
AA seq 1259 aa
MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLP
GAQLPAAGGRGNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGA
EANHLHESDAQIENCNNILAKERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDP
EEILYNLGFGRDEPDIASKIPSRFFNSSSFAKGIDIKVFLSAQMQRMEVENPNYALTSRF
RQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKETDPPPPLTRSNTANRLMKTLS
KLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKKESSSMLATVK
EEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD
FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAP
HVPATYQLGLTKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSC
DSETTVTSLGEDLATPTAQDQPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCN
TIENTGTKQSTCSPGDHIIEITEVEEDLFPAETVELLREASAESDVGKSSESEFTQYTTH
HILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQMKVCSLSNQRMGRSLLKSKDL
LKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPSFTYKYTPEEE
QELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS
QSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRV
CSVNPPSAIEMQLRRVLHDIRNSLQNLSQYPMMRGPDPAAAPYSTQKSSVLPLYENTFQE
LQVMRRSLNLFRTQMMDLELAMLRQQTMVYHHMTEEERFEVDQLQGLRNSVRMELQDLEL
QLEERLLGLEEQLRAVRMPSPFRSSALMGMCGSRSADNLSCPSPLNVMEPVTELMQEQSY
LKSELGLGLGEMGFEIPPGESSESVFSQATSESSSVCSGPSHANRRTGVPSTASVGKSKT
PLVARKKVFRASVALTPTAPSRTGSVQTPPDLESSEEVDAAEGAPEVVGPKSEVEEGHGK
LPSMPAAEEMHKNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASNSKQDYH
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggaccggcccctgtcgtcgtcggcggaggcggaggaggaactggagtggcaagtggcg
agtcgcaggaggaaggcctgggccaagtgccgcagctcctggcaagcgtcggagacggag
gatctgtccacagaagcgacgacgcaggacgaggaggaggacgaggaggaggacctcccc
ggcgcgcagctgccggcagcggggggaagaggaaacgtgcccaacgagaagatcgcgata
tggctcaaggactgccgtacacctttgggagcctcactggatgaacaaagcagtagtaca
ctcaagggtgtgcttgtgagaaatggaggaagttttgaagatgatttgtcattgggagct
gaagccaaccacctccatgaaagtgatgctcaaattgaaaactgcaataatatcttggcc
aaagagagaagattacagtttcatcagaaagggagaagtatgaattccactggatctggg
aaaagtagtgggacagtttcaagtgtttcagaattgttggaactttatgaggaagatcct
gaagaaattctttataatcttggatttggacgtgatgaaccagatattgcttctaaaatt
ccttccagattttttaattcatcatcctttgccaaagggatagatattaaagtatttttg
agtgctcagatgcaacggatggaagtagaaaacccaaattatgctttaacaagccgtttt
cgtcaaattgaagtgcttactactgtggccaatgcgttttcttctttatattctcaagtc
tccgggacgcccctgcagagaattggaagtatgtcctcagtgacctctaacaaggagaca
gacccacctccacctttaactcgaagtaacactgcaaatcgtttaatgaaaacactctca
aaactgaatttatgtgttgataaaacagagaaaggagaaagtagtagtccttctccatca
gctgaaaaaggaaagattctaaatgtttcagtgattgaagaaagtggcaataaaaacgat
caaaagtctcaaaaaattatgaagaagaaagagtcatcttctatgttggctacagttaaa
gaagaagtctctggtagttcagcagctgttacggagaatgctgatagtgatagaatttct
gatgaagcaaatagtaattttaaccaaggaactgaaaatgaacaaagtaaagaaactcaa
agtcatgagagtaaactgggtgaggaatctggtattgtagaatccaaattagatagtgat
ttcaacatatccagccacagtgagctggaaaatagcagtgagctgaaaagtgtccatata
tccacacctgaaaaagagccttgtgcaccactgacaataccatccataagaaatataatg
acacagcagaaggactccttcgaaatggaagaggttcaaagtacggagggagaagctcct
catgttccagccacttaccagctaggtcttacgaagtcgaaaagagatcatctgttacgt
actgcaagtcagcattccgatagcagtggttttgctgaagattctacagactgcctatcc
cttaatcatcttcaggttcaggagtccttgcaggctatggggagtagtgctgatagttgt
gacagtgagacaacagttacgtcacttggtgaagaccttgccacaccaacagcacaagac
cagccttattttaatgaatcagaggaggagtctcttgtccctcttcagaagggactagag
aaggcagcagcagttgcagacaaaagaaaatcaggtagccaggatttccctcagtgcaac
accattgagaatacaggaactaaacagtccacctgtagtccaggggatcatatcattgaa
attactgaagtggaagaggatttgtttccagcagagacagtagagctactgagggaagca
agtgctgaaagtgatgtgggtaaaagcagtgaaagtgaatttactcagtataccacacac
catattctgaaatcattggcttctattgaagctaaatgcagtgatatgagctctgaaaat
acaactgggcctccctcttccatggacagagttaatacagctttgcaaagagctcaaatg
aaggtttgcagtctgtctaatcaaaggatggggcgtagcctgctaaaatcaaaagatttg
ttaaaacaaaggtacttatttgcaaaagctggctatcctctaagaaggtctcagtcttta
ccaaccaccttattgagcccagtaagggttgtgtcctctgtcaatgttcgattatctcca
ggaaaagagaccagatgcagcccaccttccttcacctataagtacacacctgaagaggag
caggaattggaaaagcgggtgatggaacatgatggtcagtctttagttaaatcgaccatt
ttcatctctccatcatctgtgaagaaagaagaagccccccagagtgaggcgccgcgggtg
gaggaatgccatcatggaaggactcctacctgttcacggcttgctccaccaccaatgtct
cagtctacctgttcccttcattccatccactctgagtggcaagaaaggcccctgtgtgag
cacacaagaactctgagcactcacagtgttcccaacatatcaggggctacttgtagtgcc
ttcgcttcccctttcgggtgtccttactcacatagacatgccacctacccttaccgagtg
tgctctgtgaatcctccttcagccatagaaatgcagttgcgaagagtattacatgatatt
agaaactcactgcagaatctttcacagtaccctatgatgagaggacctgatcctgctgct
gctccatatagtactcagaaatcatctgttctacctctttatgaaaatacttttcaggag
ctccaggtaatgaggcggagcctgaatttgtttagaacacaaatgatggatttagaattg
gcaatgctgcgtcagcaaaccatggtttatcatcatatgactgaggaggagaggtttgaa
gttgatcagctccagggtttgagaaattcagtccgaatggaacttcaggacctggaactg
cagctggaggagcgcctgctgggcctggaggagcagcttcgtgctgtgcgcatgccttca
cccttccgctcctccgcactcatgggaatgtgtggcagtagaagcgctgataacttgtca
tgcccttctccattgaatgtaatggaaccagtcactgaactgatgcaggagcagtcatac
ctgaagtctgaattgggcctgggacttggagaaatgggatttgaaattcctcctggagaa
agctcagaatctgttttttcccaagcaacatcagaatcatcttctgtatgttctggtccc
tctcatgctaacagaagaactggagtaccttctactgcctcagtgggcaaatccaaaacc
ccattagtggcaaggaagaaagtgttccgagcatcggtggctctaacgccaacagctcct
tctagaacaggctctgtgcagacacctccagatttggaaagttctgaggaagttgatgca
gctgaaggagccccagaagttgtaggacctaaatctgaagtggaagaagggcatggaaaa
ctcccatcaatgccagctgctgaggaaatgcataaaaatgtggagcaagatgagttgcag
caagtcatacgggagattaaagagtctattgttggggaaatcagacgggaaattgtaagt
ggacttttggcagcagtatcttcaagtaaagcgtctaattctaagcaagattatcattaa

DBGET integrated database retrieval system