KEGG   Homo sapiens (human): 6745Help
Entry
6745              CDS       T01001                                 

Gene name
SSR1, TRAPA
Definition
(RefSeq) signal sequence receptor subunit 1
  KO
K13249  translocon-associated protein subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00402  Translocon-associated protein (TRAP) complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6745 (SSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAP_alpha
Motif
Other DBs
NCBI-GeneID: 6745
NCBI-ProteinID: NP_003135
OMIM: 600868
HGNC: 11323
Ensembl: ENSG00000124783
Vega: OTTHUMG00000014202
Pharos: P43307(Tbio)
UniProt: P43307
Position
6p24.3
AA seq 286 aa AA seqDB search
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDE
PTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
NGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQK
VEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagactcctcccccgcttgctgctgcttctcttactcgtgttccctgccactgtcttg
ttccgaggcggccccagaggcttgttagcagtggcacaagatcttacagaggatgaagaa
acagtagaagattccataattgaggatgaagatgatgaagccgaggtagaagaagatgaa
cccacagatttggtagaagataaagaggaagaagatgtgtctggtgaacctgaagcttca
ccgagtgcagatacaactatactgtttgtaaaaggagaagattttccagcaaataacatt
gtgaagttcctggtaggctttaccaacaagggtacagaagattttattgttgaatcctta
gatgcctcattccgttatcctcaggactaccagttttatatccagaatttcacagctctt
cctctgaacactgtagtgccaccccagagacaggcaacttttgagtactctttcattcct
gcagagcccatgggcggacgaccatttggtttggtcatcaatctgaactacaaagatttg
aacggcaatgtattccaagatgcagtcttcaatcaaacagttacagttattgaaagagag
gatgggttagatggagaaacaatctttatgtatatgttccttgctggtcttgggcttctg
gttattgttggccttcatcaactcctagaatctagaaagcgtaagagacccatacagaaa
gtagaaatgggtacatcaagtcagaatgatgttgacatgagttggattcctcaggaaaca
ttgaatcaaatcaataaagcttcaccaagaaggttgcccaggaaacgggcacagaagaga
tcagtgggatctgatgagtaa

DBGET integrated database retrieval system