KEGG   Homo sapiens (human): 6745
Entry
6745              CDS       T01001                                 

Symbol
SSR1, TRAPA
Name
(RefSeq) signal sequence receptor subunit 1
  KO
K13249  translocon-associated protein subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6745 (SSR1)
SSDB
Motif
Pfam: TRAP_alpha
Other DBs
NCBI-GeneID: 6745
NCBI-ProteinID: NP_003135
OMIM: 600868
HGNC: 11323
Ensembl: ENSG00000124783
Vega: OTTHUMG00000014202
Pharos: P43307(Tbio)
UniProt: P43307
Position
6p24.3
AA seq 286 aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDE
PTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
NGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQK
VEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagactcctcccccgcttgctgctgcttctcttactcgtgttccctgccactgtcttg
ttccgaggcggccccagaggcttgttagcagtggcacaagatcttacagaggatgaagaa
acagtagaagattccataattgaggatgaagatgatgaagccgaggtagaagaagatgaa
cccacagatttggtagaagataaagaggaagaagatgtgtctggtgaacctgaagcttca
ccgagtgcagatacaactatactgtttgtaaaaggagaagattttccagcaaataacatt
gtgaagttcctggtaggctttaccaacaagggtacagaagattttattgttgaatcctta
gatgcctcattccgttatcctcaggactaccagttttatatccagaatttcacagctctt
cctctgaacactgtagtgccaccccagagacaggcaacttttgagtactctttcattcct
gcagagcccatgggcggacgaccatttggtttggtcatcaatctgaactacaaagatttg
aacggcaatgtattccaagatgcagtcttcaatcaaacagttacagttattgaaagagag
gatgggttagatggagaaacaatctttatgtatatgttccttgctggtcttgggcttctg
gttattgttggccttcatcaactcctagaatctagaaagcgtaagagacccatacagaaa
gtagaaatgggtacatcaagtcagaatgatgttgacatgagttggattcctcaggaaaca
ttgaatcaaatcaataaagcttcaccaagaaggttgcccaggaaacgggcacagaagaga
tcagtgggatctgatgagtaa

KEGG   Homo sapiens (human): 6746
Entry
6746              CDS       T01001                                 

Symbol
SSR2, HSD25, TLAP, TRAP-BETA, TRAPB
Name
(RefSeq) signal sequence receptor subunit 2
  KO
K13250  translocon-associated protein subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6746 (SSR2)
SSDB
Motif
Pfam: TRAP_beta BatD Yop-YscD_cpl
Other DBs
NCBI-GeneID: 6746
NCBI-ProteinID: NP_003136
OMIM: 600867
HGNC: 11324
Ensembl: ENSG00000163479
Vega: OTTHUMG00000017456
Pharos: P43308(Tbio)
UniProt: P43308
Position
1q22
AA seq 183 aa
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaggctgctgtcatttgtggtgttggctctatttgctgtcactcaagcagaggaagga
gccaggcttttggcttccaaatcactgctgaacagatacgccgtggagggacgagacctg
accttgcagtacaacatctacaatgttggctcaagtgctgcattagacgtggaactatct
gatgattccttccctccagaagactttggcattgtgtctggaatgctcaatgtcaaatgg
gaccggattgcccctgctagcaatgtctcccacactgtggtcctgcgccctctcaaggct
ggttatttcaacttcacctcggcaacaattacttacctggcccaggaggatgggcccgtt
gtgattggctctaccagtgcacctggacagggaggaatcctggctcagcgggagtttgac
aggcgattctcccctcattttctggactgggcagcctttggggtcatgacccttccctcc
atcggcatccccctgctattgtggtactccagcaagaggaaatatgacactcccaaaacg
aagaagaactga

KEGG   Homo sapiens (human): 6747
Entry
6747              CDS       T01001                                 

Symbol
SSR3, TRAPG
Name
(RefSeq) signal sequence receptor subunit 3
  KO
K13251  translocon-associated protein subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6747 (SSR3)
SSDB
Motif
Pfam: TRAP-gamma Renin_r
Other DBs
NCBI-GeneID: 6747
NCBI-ProteinID: NP_009038
OMIM: 606213
HGNC: 11325
Ensembl: ENSG00000114850
Vega: OTTHUMG00000158632
Pharos: Q9UNL2(Tdark)
UniProt: Q9UNL2
Position
3q25.31
AA seq 185 aa
MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV
LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER
ILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALL
STGSK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcctaaaggcagctccaaacagcagtctgaggaggacctgctcctgcaggatttc
agccgcaatctctcggccaagtcctccgcgctcttcttcggaaacgcgttcatcgtgtct
gccatccccatctggttatactggcgaatatggcatatggatcttattcagtctgctgtt
ttgtatagtgtgatgaccctagtaagcacatatttggtagcctttgcatacaagaatgtg
aaatttgttctcaagcacaaagtagcacagaagagggaggatgctgtttccaaagaagtg
actcgaaaactttctgaagctgataatagaaagatgtctcggaaggagaaagatgaaaga
atcttgtggaagaagaatgaagttgctgattatgaagctacaacattttccatcttctat
aacaacactctgttcctggtcgtggtcattgttgcttccttcttcatattgaagaacttc
aaccccacagtgaactacatattgtccataagtgcttcatcaggactcatcgccctcctg
tctactggctccaaatag

KEGG   Homo sapiens (human): 6748
Entry
6748              CDS       T01001                                 

Symbol
SSR4, CDG1Y, TRAPD
Name
(RefSeq) signal sequence receptor subunit 4
  KO
K04571  translocon-associated protein subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6748 (SSR4)
SSDB
Motif
Pfam: TRAP-delta
Other DBs
NCBI-GeneID: 6748
NCBI-ProteinID: NP_006271
OMIM: 300090
HGNC: 11326
Ensembl: ENSG00000180879
Vega: OTTHUMG00000024212
Pharos: P51571(Tdark)
UniProt: P51571
Position
Xq28
AA seq 173 aa
MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNR
VQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQR
NNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcggcgatggcatctctcggcgccctggcgctgctcctgctgtccagcctctcccgc
tgctcagccgaggcctgcctggagccccagatcaccccttcctactacaccacttctgac
gctgtcatttccactgagaccgtcttcattgtggagatctccctgacatgcaagaacagg
gtccagaacatggctctctatgctgacgtcggtggaaaacaattccctgtcactcgaggc
caggatgtggggcgttatcaggtgtcctggagcctggaccacaagagcgcccacgcaggc
acctatgaggttagattcttcgacgaggagtcctacagcctcctcaggaaggctcagagg
aataacgaggacatttccatcatcccgcctctgtttacagtcagcgtggaccatcggggc
acttggaacgggccctgggtgtccactgaggtgctggctgcggcgatcggccttgtgatc
tactacttggccttcagtgcgaagagccacatccaggcctga

DBGET integrated database retrieval system