KEGG   Homo sapiens (human): 6747Help
Entry
6747              CDS       T01001                                 

Gene name
SSR3, TRAPG
Definition
(RefSeq) signal sequence receptor subunit 3
  KO
K13251  translocon-associated protein subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6747 (SSR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAP-gamma Renin_r SPC25
Motif
Other DBs
NCBI-GeneID: 6747
NCBI-ProteinID: NP_009038
OMIM: 606213
HGNC: 11325
Ensembl: ENSG00000114850
Vega: OTTHUMG00000158632
Pharos: Q9UNL2(Tdark)
UniProt: Q9UNL2
Position
3q25.31
AA seq 185 aa AA seqDB search
MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV
LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER
ILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALL
STGSK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaaaggcagctccaaacagcagtctgaggaggacctgctcctgcaggatttc
agccgcaatctctcggccaagtcctccgcgctcttcttcggaaacgcgttcatcgtgtct
gccatccccatctggttatactggcgaatatggcatatggatcttattcagtctgctgtt
ttgtatagtgtgatgaccctagtaagcacatatttggtagcctttgcatacaagaatgtg
aaatttgttctcaagcacaaagtagcacagaagagggaggatgctgtttccaaagaagtg
actcgaaaactttctgaagctgataatagaaagatgtctcggaaggagaaagatgaaaga
atcttgtggaagaagaatgaagttgctgattatgaagctacaacattttccatcttctat
aacaacactctgttcctggtcgtggtcattgttgcttccttcttcatattgaagaacttc
aaccccacagtgaactacatattgtccataagtgcttcatcaggactcatcgccctcctg
tctactggctccaaatag

DBGET integrated database retrieval system