KEGG   Homo sapiens (human): 6748Help
Entry
6748              CDS       T01001                                 

Gene name
SSR4, CDG1Y, TRAPD
Definition
(RefSeq) signal sequence receptor subunit 4
  KO
K04571  translocon-associated protein subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6748 (SSR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAP-delta
Motif
Other DBs
NCBI-GeneID: 6748
NCBI-ProteinID: NP_006271
OMIM: 300090
HGNC: 11326
Ensembl: ENSG00000180879
Vega: OTTHUMG00000024212
Pharos: P51571(Tdark)
UniProt: P51571
Position
Xq28
AA seq 173 aa AA seqDB search
MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNR
VQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQR
NNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatggcatctctcggcgccctggcgctgctcctgctgtccagcctctcccgc
tgctcagccgaggcctgcctggagccccagatcaccccttcctactacaccacttctgac
gctgtcatttccactgagaccgtcttcattgtggagatctccctgacatgcaagaacagg
gtccagaacatggctctctatgctgacgtcggtggaaaacaattccctgtcactcgaggc
caggatgtggggcgttatcaggtgtcctggagcctggaccacaagagcgcccacgcaggc
acctatgaggttagattcttcgacgaggagtcctacagcctcctcaggaaggctcagagg
aataacgaggacatttccatcatcccgcctctgtttacagtcagcgtggaccatcggggc
acttggaacgggccctgggtgtccactgaggtgctggctgcggcgatcggccttgtgatc
tactacttggccttcagtgcgaagagccacatccaggcctga

DBGET integrated database retrieval system