KEGG   Homo sapiens (human): 6750Help
Entry
6750              CDS       T01001                                 

Gene name
SST, SMST
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    6750 (SST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Somatostatin
Motif
Other DBs
NCBI-GeneID: 6750
NCBI-ProteinID: NP_001039
OMIM: 182450
HGNC: 11329
Ensembl: ENSG00000157005
Vega: OTTHUMG00000156462
Pharos: P61278(Tbio)
CPD: C16021 C16022
UniProt: P61278
Position
3q27.3
AA seq 116 aa AA seqDB search
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctgccgcctccagtgcgcgctggctgcgctgtccatcgtcctggccctgggc
tgtgtcaccggcgctccctcggaccccagactccgtcagtttctgcagaagtccctggct
gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc
aaccagacggagaatgatgccctggaacctgaagatctgtcccaggctgctgagcaggat
gaaatgaggcttgagctgcagagatctgctaactcaaacccggctatggcaccccgagaa
cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system