KEGG   Homo sapiens (human): 6751Help
Entry
6751              CDS       T01001                                 

Gene name
SSTR1, SRIF-2, SS-1-R, SS1-R, SS1R
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  somatostatin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Drug target
Pasireotide (DG00503): D10147 D10497 D10566
Seglitide acetate: D05812
Somatostatin: D07431
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6751 (SSTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6751 (SSTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6751 (SSTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6751 (SSTR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6751 (SSTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 T2SSM Piezo_RRas_bdg
Motif
Other DBs
NCBI-GeneID: 6751
NCBI-ProteinID: NP_001040
OMIM: 182451
HGNC: 11330
Ensembl: ENSG00000139874
Vega: OTTHUMG00000140249
Pharos: P30872(Tclin)
UniProt: P30872 Q86SW9
Position
14q21.1
AA seq 391 aa AA seqDB search
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctccttcctcctctcctagccccagcccgggcagc
tgcggcgaaggcggcggcagcaggggccccggggccggcgctgcggacggcatggaggag
ccagggcgaaatgcgtcccagaacgggaccttgagcgagggccagggcagcgccatcctg
atctctttcatctactccgtggtgtgcctggtggggctgtgtgggaactctatggtcatc
tacgtgatcctgcgctatgccaagatgaagacggccaccaacatctacatcctaaatctg
gccattgctgatgagctgctcatgctcagcgtgcccttcctagtcacctccacgttgttg
cgccactggcccttcggtgcgctgctctgccgcctcgtgctcagcgtggacgcggtcaac
atgttcaccagcatctactgtctgactgtgctcagcgtggaccgctacgtggccgtggtg
catcccatcaaggcggcccgctaccgccggcccaccgtggccaaggtagtaaacctgggc
gtgtgggtgctatcgctgctcgtcatcctgcccatcgtggtcttctctcgcaccgcggcc
aacagcgacggcacggtggcttgcaacatgctcatgccagagcccgctcaacgctggctg
gtgggcttcgtgttgtacacatttctcatgggcttcctgctgcccgtgggggctatctgc
ctgtgctacgtgctcatcattgctaagatgcgcatggtggccctcaaggccggctggcag
cagcgcaagcgctcggagcgcaagatcaccttaatggtgatgatggtggtgatggtgttt
gtcatctgctggatgcctttctacgtggtgcagctggtcaacgtgtttgctgagcaggac
gacgccacggtgagtcagctgtcggtcatcctcggctatgccaacagctgcgccaacccc
atcctctatggctttctctcagacaacttcaagcgctctttccaacgcatcctatgcctc
agctggatggacaacgccgcggaggagccggttgactattacgccaccgcgctcaagagc
cgtgcctacagtgtggaagacttccaacctgagaacctggagtccggcggcgtcttccgt
aatggcacctgcacgtcccggatcacgacgctctga

DBGET integrated database retrieval system