KEGG   Homo sapiens (human): 6752Help
Entry
6752              CDS       T01001                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor 2
  KO
K04218  somatostatin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
Drug target
Indium (111In) pentetreotide: D02108
Lanreotide: D04666
Lutetium (177Lu) oxodotreotide: D11033
Octreotide (DG00501): D00442 D02250 D05230 D06495 D11204
Pasireotide (DG00503): D10147 D10497 D10566
Seglitide acetate: D05812
Somatostatin: D07431
Vapreotide (DG00502): D06281 D09988
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    6752 (SSTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6752 (SSTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6752 (SSTR2)
  09154 Digestive system
   04971 Gastric acid secretion
    6752 (SSTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6752 (SSTR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6752 (SSTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Motif
Other DBs
NCBI-GeneID: 6752
NCBI-ProteinID: NP_001041
OMIM: 182452
HGNC: 11331
Ensembl: ENSG00000180616
Vega: OTTHUMG00000178343
Pharos: P30874(Tclin)
UniProt: P30874
Position
17q25.1
AA seq 369 aa AA seqDB search
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcggatgagccactcaatggaagccacacatggctatccattccatttgac
ctcaatggctctgtggtgtcaaccaacacctcaaaccagacagagccgtactatgacctg
acaagcaatgcagtcctcacattcatctattttgtggtctgcatcattgggttgtgtggc
aacacacttgtcatttatgtcatcctccgctatgccaagatgaagaccatcaccaacatt
tacatcctcaacctggccatcgcagatgagctcttcatgctgggtctgcctttcttggct
atgcaggtggctctggtccactggccctttggcaaggccatttgccgggtggtcatgact
gtggatggcatcaatcagttcaccagcatcttctgcctgacagtcatgagcatcgaccga
tacctggctgtggtccaccccatcaagtcggccaagtggaggagaccccggacggccaag
atgatcaccatggctgtgtggggagtctctctgctggtcatcttgcccatcatgatatat
gctgggctccggagcaaccagtgggggagaagcagctgcaccatcaactggccaggtgaa
tctggggcttggtacacagggttcatcatctacactttcattctggggttcctggtaccc
ctcaccatcatctgtctttgctacctgttcattatcatcaaggtgaagtcctctggaatc
cgagtgggctcctctaagaggaagaagtctgagaagaaggtcacccgaatggtgtccatc
gtggtggctgtcttcatcttctgctggcttcccttctacatattcaacgtttcttccgtc
tccatggccatcagccccaccccagcccttaaaggcatgtttgactttgtggtggtcctc
acctatgctaacagctgtgccaaccctatcctatatgccttcttgtctgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggagcgg
agtgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagacctccaaaccagtatctga

DBGET integrated database retrieval system