KEGG   Homo sapiens (human): 6753Help
Entry
6753              CDS       T01001                                 

Gene name
SSTR3, SS-3-R, SS3-R, SS3R, SSR-28
Definition
(RefSeq) somatostatin receptor 3
  KO
K04219  somatostatin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Drug target
Indium (111In) pentetreotide: D02108
Pasireotide (DG00503): D10147 D10497 D10566
Seglitide acetate: D05812
Somatostatin: D07431
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6753 (SSTR3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    6753 (SSTR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6753 (SSTR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6753 (SSTR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw 7tm_4 Rab5ip
Motif
Other DBs
NCBI-GeneID: 6753
NCBI-ProteinID: NP_001042
OMIM: 182453
HGNC: 11332
Ensembl: ENSG00000278195
Vega: OTTHUMG00000150537
Pharos: P32745(Tclin)
UniProt: P32745
Position
22q13.1
AA seq 418 aa AA seqDB search
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcttcatccatcatcggtgtccacgacctcagaacctgagaatgcctcctcg
gcctggcccccagatgccaccctgggcaacgtgtcggcgggcccaagcccggcagggctg
gccgtcagtggcgttctgatccccctggtctacctggtggtgtgcgtggtgggcctgctg
ggtaactcgctggtcatctatgtggtcctgcggcacacggccagcccttcagtcaccaac
gtctacatcctcaacctggcgctggccgacgagctcttcatgctggggctgcccttcctg
gccgcccagaacgccctgtcctactggcccttcggctccctcatgtgccgcctggtcatg
gcggtggatggcatcaaccagttcaccagcatattctgcctgactgtcatgagcgtggac
cgctacctggccgtggtacatcccacccgctcggcccgctggcgcacagctccggtggcc
cgcacggtcagcgcggctgtgtgggtggcctcagccgtggtggtgctgcccgtggtggtc
ttctcgggagtgccccgcggcatgagcacctgccacatgcagtggcccgagccggcggcg
gcctggcgagccggcttcatcatctacacggccgcactgggcttcttcgggccgctgctg
gtcatctgcctctgctacctgctcatcgtggtgaaggtgcgctcagctgggcgccgggtg
tgggcaccctcgtgccagcggcggcggcgctccgaacgcagggtcacgcgcatggtggtg
gccgtggtggcgctcttcgtgctctgctggatgcccttctacgtgctcaacatcgtcaac
gtggtgtgcccactgcccgaggagcctgccttctttgggctctacttcctggtggtggcg
ctgccctatgccaacagctgtgccaaccccatcctttatggcttcctctcctaccgcttc
aagcagggcttccgcagggtcctgctgcggccctcccgccgtgtgcgcagccaggagccc
actgtggggcccccggagaagactgaggaggaggatgaggaggaggaggatggggaggag
agcagggaggggggcaaggggaaggagatgaacggccgggtcagccagatcacgcagcct
ggcaccagcgggcaggagcggccgcccagcagagtggccagcaaggagcagcagctccta
ccccaagaggcttccactggggagaagtccagcacgatgcgcatcagctacctgtag

DBGET integrated database retrieval system