KEGG   Homo sapiens (human): 6754Help
Entry
6754              CDS       T01001                                 

Gene name
SSTR4, SS-4-R, SS4-R, SS4R
Definition
(RefSeq) somatostatin receptor 4
  KO
K04220  somatostatin receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Seglitide acetate: D05812
Somatostatin: D07431
Veldoreotide: D11192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6754 (SSTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6754 (SSTR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Somatostatin
    6754 (SSTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw 7tm_4
Motif
Other DBs
NCBI-GeneID: 6754
NCBI-ProteinID: NP_001043
OMIM: 182454
HGNC: 11333
Ensembl: ENSG00000132671
Vega: OTTHUMG00000032054
Pharos: P31391(Tclin)
UniProt: P31391
Position
20p11.21
AA seq 388 aa AA seqDB search
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccctcgacgctgccccccgggggcgaggaagggctggggacggcctggccc
tctgcagccaatgccagtagcgctccggcggaggcggaggaggcggtggcggggcccggg
gacgcgcgggcggcgggcatggtcgctatccagtgcatctacgcgctggtgtgcctggtg
gggctggtgggcaacgccctggtcatcttcgtgatccttcgctacgccaagatgaagacg
gctaccaacatctacctgctcaacctggccgtagccgacgagctcttcatgctgagcgtg
cccttcgtggcctcgtcggccgccctgcgccactggcccttcggctccgtgctgtgccgc
gcggtgctcagcgtcgacggcctcaacatgttcaccagcgtcttctgtctcaccgtgctc
agcgtggaccgctacgtggccgtggtgcaccctctgcgcgcggcgacctaccggcggccc
agcgtggccaagctcatcaacctgggcgtgtggctggcatccctgttggtcactctcccc
atcgccatcttcgcagacaccagaccggctcgcggcggccaggccgtggcctgcaacctg
cagtggccacacccggcctggtcggcagtcttcgtggtctacactttcctgctgggcttc
ctgctgcccgtgctggccattggcctgtgctacctgctcatcgtgggcaagatgcgcgcc
gtggccctgcgcgctggctggcagcagcgcaggcgctcggagaagaaaatcaccaggctg
gtgctgatggtcgtggtcgtctttgtgctctgctggatgcctttctacgtggtgcagctg
ctgaacctcttcgtgaccagccttgatgccaccgtcaaccacgtgtcccttatccttagc
tatgccaacagctgcgccaaccccattctctatggcttcctctccgacaacttccgccga
ttcttccagcgggttctctgcctgcgctgctgcctcctggaaggtgctggaggtgctgag
gaggagcccctggactactatgccactgctctcaagagcaaaggtggggcagggtgcatg
tgccccccactcccctgccagcaggaagccctgcaaccagaacccggccgcaagcgcatc
cccctcaccaggaccaccaccttctga

DBGET integrated database retrieval system