KEGG   Homo sapiens (human): 676Help
Entry
676               CDS       T01001                                 

Gene name
BRDT, BRD6, CT9, SPGF21
Definition
(RefSeq) bromodomain testis associated
  KO
K11724  bromodomain testis-specific protein
Organism
hsa  Homo sapiens (human)
Disease
H01282  Spermatogenic failure
Drug target
Apabetalone: D11131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    676 (BRDT)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    676 (BRDT)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   676 (BRDT)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    676 (BRDT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET BRD4_CDT DUF2079
Motif
Other DBs
NCBI-GeneID: 676
NCBI-ProteinID: NP_001229734
OMIM: 602144
HGNC: 1105
Ensembl: ENSG00000137948
Vega: OTTHUMG00000010113
Pharos: Q58F21(Tchem)
UniProt: Q58F21
Structure
PDB: 

Position
1p22.1
AA seq 947 aa AA seqDB search
MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVK
LQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQ
ALEKLFMQKLSQMPQEEQVVGVKERIKKGTQQNIAVSSAKEKSSPSATEKVFKQQEIPSV
FPKTSISPLNVVQGASVNSSSQTAAQVTKGVKRKADTTTPATSAVKASSEFSPTFTEKSV
ALPPIKENMPKNVLPDSQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVD
VNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVT
MARMLQDVFETHFSKIPIEPVESMPLCYIKTDITETTGRENTNEASSEGNSSDDSEDERV
KRLAKLQEQLKAVHQQLQVLSQVPFRKLNKKKEKSKKEKKKEKVNNSNENPRKMCEQMRL
KEKSKRNQPKKRKQQFIGLKSEDEDNAKPMNYDEKRQLSLNINKLPGDKLGRVVHIIQSR
EPSLSNSNPDEIEIDFETLKASTLRELEKYVSACLRKRPLKPPAKKIMMSKEELHSQKKQ
ELEKRLLDVNNQLNSRKRQTKSDKTQPSKAVENVSRLSESSSSSSSSSESESSSSDLSSS
DSSDSESEMFPKFTEVKPNDSPSKENVKKMKNECIPPEGRTGVTQIGYCVQDTTSANTTL
VHQTTPSHVMPPNHHQLAFNYQELEHLQTVKNISPLQILPPSGDSEQLSNGITVMHPSGD
SDTTMLESECQAPVQKDIKIKNADSWKSLGKPVKPSGVMKSSDELFNQFRKAAIEKEVKA
RTQELIRKHLEQNTKELKASQENQRDLGNGLTVESFSNKIQNKCSGEEQKEHQQSSEAQD
KSKLWLLKDRDLARQKEQERRRREAMVGTIDMTLQSDIMTMFENNFD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgccaagtcgacaaacagctattattgttaaccctcctccaccagaatatata
aatactaagaaaaatgggcgattgacaaatcaacttcagtatctacaaaaagttgtccta
aaggatttatggaagcatagtttttcatggccctttcaacgtcctgtggatgctgtgaaa
ctacagttgcctgattattataccattataaaaaacccaatggatttaaatacaattaag
aagcgcttggagaataaatattatgcgaaggcttcagaatgtatagaagacttcaataca
atgttctcaaattgttatttatataacaagcctggagatgacattgttcttatggcacaa
gctctagagaagctgtttatgcagaaattatctcagatgccacaagaagagcaagttgtg
ggtgttaaggaaagaatcaagaaaggcactcaacagaatatagctgtttcttctgctaaa
gaaaaatcatcacccagcgcaacagaaaaagtatttaagcagcaagaaattccttctgta
tttcctaagacatctatttctcccttgaacgtggtacagggagcttcagtcaactccagt
tcacaaactgcggcccaagttacaaaaggtgtgaagaggaaagcagatacaacaactcct
gcaacttcagcagttaaagcaagtagtgaattttctccaacattcacagaaaaatcagtg
gcactgccacctataaaagaaaatatgccaaagaatgttttgccagattctcagcaacaa
tataatgttgtgaagactgttaaagtaactgaacaattaaggcactgtagtgagattctt
aaagaaatgcttgcaaagaaacatttttcatatgcatggcccttttataatcctgttgac
gttaatgctttgggactccataactactatgacgttgtcaaaaatccgatggatcttgga
actattaaggagaaaatggataaccaagaatataaggatgcatacaaatttgcggcagat
gttagattaatgttcatgaattgctacaagtacaatcctccagatcacgaagttgtgaca
atggcaagaatgcttcaggatgttttcgaaacgcatttttcaaagatcccgattgaacct
gttgagagtatgcctttatgttacatcaaaacagatatcacagaaaccactggtagagag
aacactaatgaagcctcctctgaagggaactcttctgatgattctgaagatgagcgagtt
aagcgtcttgcaaagcttcaggagcagcttaaagctgtacatcaacagctccaggttttg
tcccaagtacctttccgtaagctaaataaaaagaaagagaagtctaaaaaggaaaagaaa
aaagaaaaggttaataacagcaatgaaaatccaagaaaaatgtgtgagcaaatgaggcta
aaggaaaagtccaagagaaatcagccaaagaaaaggaaacaacagttcattggtctaaaa
tctgaagatgaagataatgctaaacctatgaactatgatgagaaaaggcagttaagtctg
aatataaacaaactccctggagataaacttgggcgagtagttcacataatacaatcaaga
gagccttctctgagcaattccaatcctgatgagatagagatagactttgaaacactgaaa
gcatcaacactaagagaattagaaaaatatgtttcggcatgtctaagaaagagaccatta
aaacctcctgctaagaaaataatgatgtccaaagaagaacttcactcacagaaaaaacag
gaattggaaaagcggttactggatgttaataatcagttaaattctagaaaacgtcaaaca
aaatctgataaaacgcaaccatccaaagctgttgaaaatgtttcccgactgagtgagagc
agcagcagcagcagcagctcatcagagtctgaaagtagcagcagtgacttaagctcttca
gacagcagtgattctgaatcagaaatgttccctaagtttacagaagtaaaaccaaatgat
tctccttctaaagagaatgtaaagaaaatgaagaatgaatgcataccgcctgaaggaaga
acaggcgtcacacagataggatattgtgtgcaagacacaacctctgccaatactaccctt
gttcatcagaccacaccttcacatgtaatgccaccaaatcaccaccaattagcatttaat
tatcaagaattagaacatttacagactgtgaaaaacatttcacctttacaaattctgcct
ccctcaggtgattctgaacagctctcaaatggcataactgtgatgcatccatctggtgat
agtgacacaacgatgttagaatctgaatgtcaagctcctgtacagaaggatataaagatt
aagaatgcagattcatggaaaagtttaggcaaaccagtgaaaccatcaggtgtaatgaaa
tcctcagatgagctcttcaaccaatttagaaaagcagccatagaaaaggaagtaaaagct
cggacacaggaactcatacggaagcatttggaacaaaatacaaaggaactaaaagcatct
caagaaaatcagagggatcttgggaatggattgactgtagaatctttttcaaataaaata
caaaacaagtgctctggagaagagcagaaagaacatcagcagtcatcagaagctcaagat
aaatccaaactctggcttctcaaagaccgtgatttagcaaggcagaaagaacaagagagg
aggaggagagaagcaatggtgggtaccattgatatgacccttcaaagtgacattatgaca
atgtttgaaaacaactttgattaa

DBGET integrated database retrieval system