KEGG   Homo sapiens (human): 6760Help
Entry
6760              CDS       T01001                                 

Gene name
SS18, SSXT, SYT
Definition
(RefSeq) SS18 subunit of BAF chromatin remodeling complex
  KO
K15623  protein SSXT
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00142  SYT-SSX fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6760 (SS18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSXT
Motif
Other DBs
NCBI-GeneID: 6760
NCBI-ProteinID: NP_001007560
OMIM: 600192
HGNC: 11340
Ensembl: ENSG00000141380
Vega: OTTHUMG00000179425
Pharos: Q15532(Tbio)
UniProt: Q15532 A0A024RC40
Position
18q11.2
AA seq 418 aa AA seqDB search
MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVY
LATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQ
NQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMT
MSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQ
GNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGY
QQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPG
QQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggctttcgcggccccgaggcagcgaggcaagggggagatcactcccgctgcg
attcagaagatgttggatgacaataaccatcttattcagtgtataatggactctcagaat
aaaggaaagacctcagagtgttctcagtatcagcagatgttgcacacaaacttggtatac
cttgctacaatagcagattctaatcaaaatatgcagtctcttttaccagcaccacccaca
cagaatatgcctatgggtcctggagggatgaatcagagcggccctcccccacctccacgc
tctcacaacatgccttcagatggaatggtaggtgggggtcctcctgcaccgcacatgcag
aaccagatgaacggccagatgcctgggcctaaccatatgcctatgcagggacctggaccc
aatcaactcaatatgacaaacagttccatgaatatgccttcaagtagccatggatccatg
ggaggttacaaccattctgtgccatcatcacagagcatgccagtacagaatcagatgaca
atgagtcagggacaaccaatgggaaactatggtcccagaccaaatatgagtatgcagcca
aaccaaggtccaatgatgcatcagcagcctccttctcagcaatacaatatgccacaggga
ggcggacagcattaccaaggacagcagccacctatgggaatgatgggtcaagttaaccaa
ggcaatcatatgatgggtcagagacagattcctccctatagacctcctcaacagggccca
ccacagcagtactcaggccaggaagactattacggggaccaatacagtcatggtggacaa
ggtcctccagaaggcatgaaccagcaatattaccctgatggtcataatgattacggttat
cagcaaccgtcgtatcctgaacaaggctacgataggccttatgaggattcctcacaacat
tactacgaaggaggaaattcacagtatggccaacagcaagatgcataccagggaccacct
ccacaacagggatatccaccccagcagcagcagtacccagggcagcaaggttacccagga
cagcagcagggctacggtccttcacagggtggtccaggtcctcagtatcctaactaccca
cagggacaaggtcagcagtatggaggatatagaccaacacagcctggaccaccacagcca
ccccagcagaggccttatggatatgaccagggacagtatggaaattaccagcagtga

DBGET integrated database retrieval system