KEGG   Homo sapiens (human): 6767Help
Entry
6767              CDS       T01001                                 

Gene name
ST13, AAG2, FAM10A1, FAM10A4, HIP, HOP, HSPABP, HSPABP1, P48, PRO0786, SNC6
Definition
(RefSeq) ST13 Hsp70 interacting protein
  KO
K09560  suppressor of tumorigenicity protein 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    6767 (ST13)
   04131 Membrane trafficking [BR:hsa04131]
    6767 (ST13)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   6767 (ST13)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    6767 (ST13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HipN TPR_1 TPR_2 STI1 TPR_11 TPR_9 TPR_17 TPR_16 TPR_8 TPR_14 TPR_19 TPR_12
Motif
Other DBs
NCBI-GeneID: 6767
NCBI-ProteinID: NP_003923
OMIM: 606796
HGNC: 11343
Ensembl: ENSG00000100380
Vega: OTTHUMG00000151201
Pharos: P50502(Tbio)
UniProt: P50502 Q0IJ56 A0A140VKA6
Position
22q13.2
AA seq 369 aa AA seqDB search
MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP
DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA
AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD
SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM
GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK
LSAKFGGQA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacccccgcaaagtgaacgagcttcgggcctttgtgaaaatgtgtaagcaggatccg
agcgttctgcacaccgaggaaatgcgcttcctgagggagtgggtggagagcatgggtggt
aaagtaccacctgctactcagaaagctaaatcagaagaaaataccaaggaagaaaaacct
gatagtaagaaggtggaggaagacttaaaggcagacgaaccatcaagtgaggaaagtgat
ctagaaattgataaagaaggtgtgattgaaccagacactgatgctcctcaagaaatggga
gatgaaaatgcggagataacggaggagatgatggatcaggcaaatgataaaaaagtggct
gctattgaagccctaaatgatggtgaactccagaaagccattgacttattcacagatgcc
atcaagctgaatcctcgcttggccattttgtatgccaagagggccagtgtcttcgtcaaa
ttacagaagccaaatgctgccatccgagactgtgacagagccattgaaataaatcctgat
tcagctcagccttacaagtggcgggggaaagcacacagacttctaggccactgggaagaa
gcagcccatgatcttgcccttgcctgtaaattggattatgatgaagatgctagtgcaatg
ctgaaagaagttcaacctagggcacagaaaattgcagaacatcggagaaagtatgagcga
aaacgtgaagagcgagagatcaaagaaagaatagaacgagttaagaaggctcgagaagag
catgagagagcccagagggaggaagaagccagacgacagtcaggagctcagtatggctct
tttccaggtggctttcctgggggaatgcctggtaattttcccggaggaatgcctggaatg
ggagggggcatgcctggaatggctggaatgcctggactcaatgaaattcttagtgatcca
gaggttcttgcagccatgcaggatccagaagttatggtggctttccaggatgtggctcag
aacccagcaaatatgtcaaaataccagagcaacccaaaggttatgaatctcatcagtaaa
ttgtcagccaaatttggaggtcaagcgtaa

DBGET integrated database retrieval system