KEGG   Homo sapiens (human): 6770Help
Entry
6770              CDS       T01001                                 

Gene name
STAR, STARD1
Definition
(RefSeq) steroidogenic acute regulatory protein
  KO
K16931  steroidogenic acute regulatory protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa04913  Ovarian steroidogenesis
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa04979  Cholesterol metabolism
Network
N00297  ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Disease
H00216  Congenital adrenal hyperplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    6770 (STAR)
   04925 Aldosterone synthesis and secretion
    6770 (STAR)
   04927 Cortisol synthesis and secretion
    6770 (STAR)
  09154 Digestive system
   04979 Cholesterol metabolism
    6770 (STAR)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    6770 (STAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: START Polyketide_cyc
Motif
Other DBs
NCBI-GeneID: 6770
NCBI-ProteinID: NP_000340
OMIM: 600617
HGNC: 11359
Ensembl: ENSG00000147465
Vega: OTTHUMG00000164058
Pharos: P49675(Tbio)
UniProt: P49675 Q6IBK0
Structure
PDB: 

Position
8p11.23
AA seq 285 aa AA seqDB search
MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLG
SRLEETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF
RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVG
PRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT
WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagcgacattcaagctgtgcgctgggagctcctacagacacatgcgcaacatg
aaggggctgaggcaacaggctgtgatggccatcagccaggagctgaaccggagggccctg
gggggccccacccctagcacgtggattaaccaggttcggcggcggagctctctactcggt
tctcggctggaagagactctctacagtgaccaggagctggcctatctccagcagggggag
gaggccatgcagaaggccttgggcatccttagcaaccaagagggctggaagaaggagagt
cagcaggacaatggggacaaagtgatgagtaaagtggtcccagatgtgggcaaggtgttc
cggctggaggtcgtggtggaccagcccatggagaggctctatgaagagctcgtggagcgc
atggaagcaatgggggagtggaaccccaatgtcaaggagatcaaggtcctgcagaagatc
ggaaaagatacattcattactcacgagctggctgccgaggcagcaggaaacctggtgggg
ccccgtgactttgtgagcgtgcgctgtgccaagcgccgaggctccacctgtgtgctggct
ggcatggccacagacttcgggaacatgcctgagcagaagggtgtcatcagggcggagcac
ggtcccacttgcatggtgcttcacccgttggctggaagtccctctaagaccaaacttacg
tggctactcagcatcgacctcaaggggtggctgcccaagagcatcatcaaccaggtcctg
tcccagacccaggtggattttgccaaccacctgcgcaagcgcctggagtcccaccctgcc
tctgaagccaggtgttga

DBGET integrated database retrieval system