KEGG   Homo sapiens (human): 6772Help
Entry
6772              CDS       T01001                                 

Gene name
STAT1, CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
hsa05321  Inflammatory bowel disease (IBD)
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to host-cell-protein inhibition
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00486  EBV LMP1 to Jak-STAT signaling pathway
 » show all
Disease
H00089  IFN-gamma/IL-12 axis
H00363  Candidiasis
H01109  Chronic mucocutaneous candidiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6772 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6772 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6772 (STAT1)
   04621 NOD-like receptor signaling pathway
    6772 (STAT1)
   04625 C-type lectin receptor signaling pathway
    6772 (STAT1)
   04658 Th1 and Th2 cell differentiation
    6772 (STAT1)
   04659 Th17 cell differentiation
    6772 (STAT1)
   04062 Chemokine signaling pathway
    6772 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    6772 (STAT1)
   04919 Thyroid hormone signaling pathway
    6772 (STAT1)
  09158 Development
   04380 Osteoclast differentiation
    6772 (STAT1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6772 (STAT1)
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    6772 (STAT1)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    6772 (STAT1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6772 (STAT1)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    6772 (STAT1)
  09172 Infectious diseases: Viral
   05162 Measles
    6772 (STAT1)
   05164 Influenza A
    6772 (STAT1)
   05161 Hepatitis B
    6772 (STAT1)
   05160 Hepatitis C
    6772 (STAT1)
   05168 Herpes simplex infection
    6772 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6772 (STAT1)
   05169 Epstein-Barr virus infection
    6772 (STAT1)
   05165 Human papillomavirus infection
    6772 (STAT1)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    6772 (STAT1)
   05140 Leishmaniasis
    6772 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6772 (STAT1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6772 (STAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Motif
Other DBs
NCBI-GeneID: 6772
NCBI-ProteinID: NP_009330
OMIM: 600555
HGNC: 11362
Ensembl: ENSG00000115415
Vega: OTTHUMG00000132699
Pharos: P42224(Tchem)
UniProt: P42224
Structure
PDB: 

Position
2q32.2
AA seq 750 aa AA seqDB search
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggtacgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagttttcccatggaaatcagacagtacctggcacagtggttagaaaag
caagactgggagcacgctgccaatgatgtttcatttgccaccatccgttttcatgacctc
ctgtcacagctggatgatcaatatagtcgcttttctttggagaataacttcttgctacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttacagctgtctgaaggaagaaaggaaaattctggaaaacgcccag
agatttaatcaggctcagtcggggaatattcagagcacagtgatgttagacaaacagaaa
gagcttgacagtaaagtcagaaatgtgaaggacaaggttatgtgtatagagcatgaaatc
aagagcctggaagatttacaagatgaatatgacttcaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ctgaatgtcactgaacttacccagaatgccctgattaatgatgaactagtggagtggaag
cggagacagcagagcgcctgtattggggggccgcccaatgcttgcttggatcagctgcag
aactggttcactatagttgcggagagtctgcagcaagttcggcagcagcttaaaaagttg
gaggaattggaacagaaatacacctacgaacatgaccctatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcagtcttttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaacgcaccctcagaggccgctggtcttgaagacaggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaagtgatgaacatggaggagtccaccaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtaattgacctcgagacgacctctctgcccgttgtggtgatctccaac
gtcagccagctcccgagcggttgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgactccaccatgtgcacgatgggctcagctttcagaa
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtctcattccgtggacg
aggttttgtaaggaaaatataaatgataaaaattttcccttctggctttggattgaaagc
atcctagaactcattaaaaaacacctgctccctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgtgccctgttgaaggaccagcagccggggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaacctgacttccatgcggttgaaccctacacgaagaaagaactttct
gctgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatctgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccagagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggctct
gtagaattcgacagtatgatgaacacagtatag

DBGET integrated database retrieval system