KEGG   Homo sapiens (human): 6778Help
Entry
6778              CDS       T01001                                 

Gene name
STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6778 (STAT6)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    6778 (STAT6)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    6778 (STAT6)
   04659 Th17 cell differentiation
    6778 (STAT6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6778 (STAT6)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6778 (STAT6)
  Infectious diseases
   05161 Hepatitis B
    6778 (STAT6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6778 (STAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 6778
NCBI-ProteinID: NP_001171549
OMIM: 601512
HGNC: 11368
Ensembl: ENSG00000166888
Vega: OTTHUMG00000171194
Pharos: P42226(Tchem)
UniProt: P42226
Structure
PDB: 

Position
12q13.3
AA seq 847 aa AA seqDB search
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcccccagaaaaagtgcagcggctctatgtc
gactttccccaacacctgcggcatcttctgggtgactggctggagagccagccctgggag
ttcctggtcggctccgacgccttctgctgcaacttggctagtgccctactttcagacact
gtccagcaccttcaggcctcggtgggagagcagggggaggggagcaccatcttgcaacac
atcagcacccttgagagcatatatcagagggaccccctgaagctggtggccactttcaga
caaatacttcaaggagagaaaaaagctgttatggaacagttccgccacttgccaatgcct
ttccactggaagcaggaagaactcaagtttaagacaggcttgcggaggctgcagcaccga
gtaggggagatccaccttctccgagaagccctgcagaagggggctgaggctggccaagtg
tctctgcacagcttgatagaaactcctgctaatgggactgggccaagtgaggccctggcc
atgctactgcaggagaccactggagagctagaggcagccaaagccctagtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccgtttgaggagagc
ctggccccactccaggagaggtgtgaaagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtggggagcttgagcccaagacccgggcatcgctgactggccgg
ctggatgaagtcctgagaaccctcgtcaccagttgcttcctggtggagaagcagcccccc
caggtactgaagactcagaccaagttccaggctggagttcgattcctgttgggcttgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgacagagaagcag
gcgcgggagctgagtgtgcctcagggtcctggggctggagcagaaagcactggagaaatc
atcaacaacactgtgcccttggagaacagcattcctgggaactgctgctctgccctgttc
aagaacctgcttctcaagaagatcaagcggtgtgagcggaagggcactgagtctgtcaca
gaggagaagtgcgctgtgctcttctctgccagcttcacacttggccccggcaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaac
aatgccaaagccactatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctgaagttcatg
gctgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtcg
cagttcaacaaggagatcctgctgggccgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtctgaccggctgatcattggc
ttcatcagcaaacagtacgttactagccttcttctcaatgagcccgacggaacctttctc
ctccgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcactgggggaccgaatccgggatcttgctcagctcaaaaatctctatcccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggtaaggatggcaggggt
tatgtcccagctaccatcaagatgaccgtggaaagggaccaaccacttcctaccccagag
ctccagatgcctaccatggtgccttcttatgaccttggaatggcccctgattcctccatg
agcatgcagcttggcccagatatggtgccccaggtgtacccaccacactctcactccatc
cccccgtatcaaggcctctccccagaagaatcagtcaacgtgttgtcagccttccaggag
cctcacctgcagatgccccccagcctgggccagatgagcctgccctttgaccagcctcac
ccccagggcctgctgccgtgccagcctcaggagcatgctgtgtccagccctgaccccctg
ctctgctcagatgtgaccatggtggaagacagctgcctgagccagccagtgacagcgttt
cctcagggcacttggattggtgaagacatattccctcctctgctgcctcccactgaacag
gacctcactaagcttctcctggaggggcaaggggagtcggggggagggtccttgggggca
cagcccctcctgcagccctcccactatgggcaatctgggatctcaatgtcccacatggac
ctaagggccaaccccagttggtga

DBGET integrated database retrieval system