KEGG   Homo sapiens (human): 6779Help
Entry
6779              CDS       T01001                                 

Gene name
STATH, STR
Definition
(RefSeq) statherin
  KO
K13914  statherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    6779 (STATH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Statherin
Motif
Other DBs
NCBI-GeneID: 6779
NCBI-ProteinID: NP_003145
OMIM: 184470
HGNC: 11369
Ensembl: ENSG00000126549
Vega: OTTHUMG00000129394
Pharos: P02808(Tbio)
UniProt: P02808
Position
4q13.3
AA seq 62 aa AA seqDB search
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQY
TF
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttgtctttgccttcatcttggctctcatggtttccatgattggagctgat
tcatctgaagagaaatttttgcgtagaattggaagattcggttatgggtatggcccttat
cagccagttccagaacaaccactatacccacaaccataccaaccacaataccaacaatat
accttttaa

DBGET integrated database retrieval system