KEGG   Homo sapiens (human): 6788Help
Entry
6788              CDS       T01001                                 

Gene name
STK3, KRS1, MST2
Definition
(RefSeq) serine/threonine kinase 3
  KO
K04412  serine/threonine kinase 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Module
hsa_M00683  Hippo signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6788 (STK3)
   04390 Hippo signaling pathway
    6788 (STK3)
   04392 Hippo signaling pathway - multiple species
    6788 (STK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6788 (STK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   6788 (STK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mst1_SARAH Pkinase_fungal Haspin_kinase Abi_2
Motif
Other DBs
NCBI-GeneID: 6788
NCBI-ProteinID: NP_006272
OMIM: 605030
HGNC: 11406
Ensembl: ENSG00000104375
Vega: OTTHUMG00000164651
Pharos: Q13188(Tchem)
UniProt: Q13188
Structure
PDB: 

Position
8q22.2
AA seq 491 aa AA seqDB search
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgccggcgcctaagagtaaactaaaaaagctgagtgaagacagtttgact
aagcagcctgaagaagtttttgatgtattagagaagcttggagaagggtcttatggaagt
gtatttaaagcaatacacaaggaatccggtcaagttgtcgcaattaaacaagtacctgtt
gaatcagatcttcaggaaataatcaaagaaatttccataatgcagcaatgtgacagccca
tatgttgtaaagtactatggcagttattttaagaatacagacctctggattgttatggag
tactgtggcgctggctctgtctcagacataattagattacgaaacaagacattaatagaa
gatgaaattgcaaccattcttaaatctacattgaaaggactagaatatttgcactttatg
agaaaaatacacagagatataaaagctggaaatattctcctcaatacagaaggacatgca
aaattggcagattttggagtggctggtcagttaacagatacaatggcaaaacgcaatact
gtaataggaactccattttggatggctcctgaggtgattcaagaaataggctataactgt
gtggccgacatctggtcccttggcattacttctatagaaatggctgaaggaaaacctcct
tatgctgatatacatccaatgagggctatttttatgattcccacaaatccaccaccaaca
ttcagaaagccagaactttggtccgatgatttcaccgattttgttaaaaagtgtttggtg
aagaatcctgagcagagagctactgcaacacaacttttacagcatccttttatcaagaat
gccaaacctgtatcaatattaagagacctgatcacagaagctatggagatcaaagctaaa
agacatgaggaacagcaacgagaattggaagaggaagaagaaaattcggatgaagatgag
ctggattcccacaccatggtgaagactagtgtggagagtgtgggcaccatgcgggccaca
agcacgatgagtgaaggggcccagaccatgattgaacataatagcacgatgttggaatcc
gacttggggaccatggtgataaacagtgaggatgaggaagaagaagatggaactatgaaa
agaaatgcaacctcaccacaagtacaaagaccatctttcatggactactttgataagcaa
gacttcaagaataagagtcacgaaaactgtaatcagaacatgcatgaacccttccctatg
tccaaaaacgtttttcctgataactggaaagttcctcaagatggagactttgactttttg
aaaaatctaagtttagaagaactacagatgcggttaaaagcactggaccccatgatggaa
cgggagatagaagaacttcgtcagagatacactgcgaaaagacagcccattctggatgcg
atggatgcaaagaaaagaaggcagcaaaacttttga

KEGG   Homo sapiens (human): 6789Help
Entry
6789              CDS       T01001                                 

Gene name
STK4, KRS2, MST1, YSK3
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04068  FoxO signaling pathway
hsa05200  Pathways in cancer
hsa05223  Non-small cell lung cancer
Network
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to EGF-EGFR-RAS-RASSF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    6789 (STK4)
   04010 MAPK signaling pathway
    6789 (STK4)
   04068 FoxO signaling pathway
    6789 (STK4)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6789 (STK4)
  09162 Cancers: Specific types
   05223 Non-small cell lung cancer
    6789 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6789 (STK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   6789 (STK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mst1_SARAH Pkinase_fungal Haspin_kinase Abi_2 DUF4611
Motif
Other DBs
NCBI-GeneID: 6789
NCBI-ProteinID: NP_006273
OMIM: 604965
HGNC: 11408
Ensembl: ENSG00000101109
Vega: OTTHUMG00000033059
Pharos: Q13043(Tchem)
UniProt: Q13043
Structure
PDB: 

Position
20q13.12
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaaccaaacaaccagaagaagtatttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtatacaaagctattcataaagagaccggccagattgttgctattaagcaa
gttcctgtggaatcagacctccaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagacatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgctgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctatggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagggccacagccactcagctcctgcagcacccattt
gtcaggagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaggatgaaatggattctggcacgatggttcgagcagtgggtgatgagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcacgatgacacg
ttgccatcacaactgggcaccatggtgatcaatgcagaggatgaggaagaggaaggaact
atgaaaagaagggatgagaccatgcagcctgcgaaaccatcctttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggtccactgaaa
aattcttcagattggaaaataccacaggatggagactacgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccatagaggctaag
aagagacggcaacaaaacttctga

DBGET integrated database retrieval system