KEGG   Homo sapiens (human): 6788Help
Entry
6788              CDS       T01001                                 

Gene name
STK3, KRS1, MST2
Definition
(RefSeq) serine/threonine kinase 3
  KO
K04412  serine/threonine kinase 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Module
hsa_M00683  Hippo signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6788 (STK3)
   04390 Hippo signaling pathway
    6788 (STK3)
   04392 Hippo signaling pathway - multiple species
    6788 (STK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6788 (STK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   6788 (STK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mst1_SARAH Haspin_kinase Abi_2
Motif
Other DBs
NCBI-GeneID: 6788
NCBI-ProteinID: NP_006272
OMIM: 605030
HGNC: 11406
Ensembl: ENSG00000104375
Vega: OTTHUMG00000164651
Pharos: Q13188(Tchem)
UniProt: Q13188
Structure
PDB: 

Position
8q22.2
AA seq 491 aa AA seqDB search
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgccggcgcctaagagtaaactaaaaaagctgagtgaagacagtttgact
aagcagcctgaagaagtttttgatgtattagagaagcttggagaagggtcttatggaagt
gtatttaaagcaatacacaaggaatccggtcaagttgtcgcaattaaacaagtacctgtt
gaatcagatcttcaggaaataatcaaagaaatttccataatgcagcaatgtgacagccca
tatgttgtaaagtactatggcagttattttaagaatacagacctctggattgttatggag
tactgtggcgctggctctgtctcagacataattagattacgaaacaagacattaatagaa
gatgaaattgcaaccattcttaaatctacattgaaaggactagaatatttgcactttatg
agaaaaatacacagagatataaaagctggaaatattctcctcaatacagaaggacatgca
aaattggcagattttggagtggctggtcagttaacagatacaatggcaaaacgcaatact
gtaataggaactccattttggatggctcctgaggtgattcaagaaataggctataactgt
gtggccgacatctggtcccttggcattacttctatagaaatggctgaaggaaaacctcct
tatgctgatatacatccaatgagggctatttttatgattcccacaaatccaccaccaaca
ttcagaaagccagaactttggtccgatgatttcaccgattttgttaaaaagtgtttggtg
aagaatcctgagcagagagctactgcaacacaacttttacagcatccttttatcaagaat
gccaaacctgtatcaatattaagagacctgatcacagaagctatggagatcaaagctaaa
agacatgaggaacagcaacgagaattggaagaggaagaagaaaattcggatgaagatgag
ctggattcccacaccatggtgaagactagtgtggagagtgtgggcaccatgcgggccaca
agcacgatgagtgaaggggcccagaccatgattgaacataatagcacgatgttggaatcc
gacttggggaccatggtgataaacagtgaggatgaggaagaagaagatggaactatgaaa
agaaatgcaacctcaccacaagtacaaagaccatctttcatggactactttgataagcaa
gacttcaagaataagagtcacgaaaactgtaatcagaacatgcatgaacccttccctatg
tccaaaaacgtttttcctgataactggaaagttcctcaagatggagactttgactttttg
aaaaatctaagtttagaagaactacagatgcggttaaaagcactggaccccatgatggaa
cgggagatagaagaacttcgtcagagatacactgcgaaaagacagcccattctggatgcg
atggatgcaaagaaaagaaggcagcaaaacttttga

KEGG   Homo sapiens (human): 6789Help
Entry
6789              CDS       T01001                                 

Gene name
STK4, KRS2, MST1, YSK3
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04068  FoxO signaling pathway
hsa05200  Pathways in cancer
hsa05223  Non-small cell lung cancer
Network
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to EGF-EGFR-RAS-RASSF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    6789 (STK4)
   04010 MAPK signaling pathway
    6789 (STK4)
   04068 FoxO signaling pathway
    6789 (STK4)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    6789 (STK4)
   05223 Non-small cell lung cancer
    6789 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6789 (STK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   6789 (STK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mst1_SARAH Haspin_kinase Abi_2 DUF4611
Motif
Other DBs
NCBI-GeneID: 6789
NCBI-ProteinID: NP_006273
OMIM: 604965
HGNC: 11408
Ensembl: ENSG00000101109
Vega: OTTHUMG00000033059
Pharos: Q13043(Tchem)
UniProt: Q13043
Structure
PDB: 

Position
20q13.12
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaaccaaacaaccagaagaagtatttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtatacaaagctattcataaagagaccggccagattgttgctattaagcaa
gttcctgtggaatcagacctccaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagacatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgctgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctatggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagggccacagccactcagctcctgcagcacccattt
gtcaggagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaggatgaaatggattctggcacgatggttcgagcagtgggtgatgagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcacgatgacacg
ttgccatcacaactgggcaccatggtgatcaatgcagaggatgaggaagaggaaggaact
atgaaaagaagggatgagaccatgcagcctgcgaaaccatcctttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggtccactgaaa
aattcttcagattggaaaataccacaggatggagactacgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccatagaggctaag
aagagacggcaacaaaacttctga

DBGET integrated database retrieval system