KEGG   Homo sapiens (human): 6790
Entry
6790              CDS       T01001                                 

Gene name
AURKA, AIK, ARK1, AURA, BTAK, PPP1R47, STK15, STK6, STK7
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Drug target
Alisertib (DG01855): D10085 D10086
Ilorasertib: D10423
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    6790 (AURKA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6790 (AURKA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6790 (AURKA)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6790 (AURKA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6790 (AURKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6790 (AURKA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   6790 (AURKA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6790 (AURKA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    6790 (AURKA)
   Spindle formation proteins
    6790 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    6790 (AURKA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal MTBP_C APH Seadorna_VP7
Other DBs
NCBI-GeneID: 6790
NCBI-ProteinID: NP_001310232
OMIM: 603072
HGNC: 11393
Ensembl: ENSG00000087586
Vega: OTTHUMG00000032796
Pharos: O14965(Tchem)
UniProt: O14965
Structure
PDB: 

Position
20q13.2
AA seq 403 aa
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcaggacctgttaaggctacagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgtaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcttcccagcgcattcctttgcaa
gcacaaaagcttgtctccagtcacaagccggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccactgaataacacccaaaagagcaagcag
cccctgccatcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaagcaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtagaaatacagtcccaccttcggcatcctaatattcttagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtttataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacttatataacagaattg
gcaaatgccctgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gaatttttagttgggaagcctccttttgaggcaaacacataccaagagacctacaaaaga
atatcacgggttgaattcacattccctgactttgtaacagagggagccagggacctcatt
tcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaacac
ccctggatcacagcaaattcatcaaaaccatcaaattgccaaaacaaagaatcagctagc
aaacagtcttag

DBGET integrated database retrieval system