KEGG   Homo sapiens (human): 6792
Entry
6792              CDS       T01001                                 
Symbol
CDKL5, CFAP247, DEE2, EIEE2, ISSX, STK9
Name
(RefSeq) cyclin dependent kinase like 5
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
H01819  Early myoclonic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6792 (CDKL5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     6792 (CDKL5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   6792 (CDKL5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 FTA2 RIO1 Haspin_kinase Pkinase_fungal
Other DBs
NCBI-GeneID: 6792
NCBI-ProteinID: NP_001310218
OMIM: 300203
HGNC: 11411
Ensembl: ENSG00000008086
Pharos: O76039(Tchem)
UniProt: O76039
Structure
Position
X:18425608..18653629
AA seq 960 aa
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGL
PANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFF
RSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLR
KLLHLSSASNHPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPA
LQLPGQMDPGWHVSSVTRSATEGPSYSEQLGAKSGPNGHPYNRTNRSRMPNLNDLKETAL
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgaagattcctaacattggtaatgtgatgaataaatttgagatccttggggttgtaggt
gaaggagcctatggagttgtacttaaatgcagacacaaggaaacacatgaaattgtggcg
atcaagaaattcaaggacagtgaagaaaatgaagaagtcaaagaaacgactttacgagag
cttaaaatgcttcggactctcaagcaggaaaacattgtggagttgaaggaagcatttcgt
cggaggggaaagttgtacttggtgtttgagtatgttgaaaaaaatatgctcgaattgctg
gaagaaatgccaaatggagttccacctgagaaagtaaaaagctacatctatcagctaatc
aaggctattcactggtgccataagaatgatattgtccatcgagatataaaaccagaaaat
ctcttaatcagccacaatgatgtcctaaaactgtgtgactttggttttgctcgtaatctg
tcagaaggcaataatgctaattacacagagtacgttgccaccagatggtatcggtcccca
gaactcttacttggcgctccctatggaaagtccgtggacatgtggtcggtgggctgtatt
cttggggagcttagcgatggacagcctttatttcctggagaaagtgaaattgaccaactt
tttactattcagaaggtgctaggaccacttccatctgagcagatgaagcttttctacagt
aatcctcgcttccatgggctccggtttccagctgttaaccatcctcagtccttggaaaga
agataccttggaattttgaatagtgttctacttgacctaatgaagaatttactgaagttg
gacccagctgacagatacttgacagaacagtgtttgaatcaccctacatttcaaacccag
agacttctggatcgttctccttcaaggtcagcaaaaagaaaaccttaccatgtggaaagc
agcacattgtctaatagaaaccaagccggcaaaagtactgctttgcagtctcaccacaga
tctaacagcaaggacatccagaacctgagtgtaggcctgccccgggctgacgaaggtctc
cctgccaatgaaagcttcctaaatggaaaccttgctggagctagtcttagtccactgcac
accaaaacctaccaagcaagcagccagcctgggtctaccagcaaagatctcaccaacaac
aacataccacaccttcttagcccaaaagaagccaagtcaaaaacagagtttgattttaat
attgacccaaagccttcagaaggcccagggacaaagtacctcaagtcaaacagcagatct
cagcagaaccgccactcattcatggaaagctctcaaagcaaagctgggacactgcagccc
aatgaaaagcagagtcggcatagctatattgacacaattccccagtcctctaggagtccc
tcctacaggaccaaggccaaaagccatggggcactgagtgactccaagtctgtgagcaac
ctttctgaagccagggcccaaattgcggagcccagtaccagtaggtacttcccatctagc
tgcttagacttgaattctcccaccagcccaacccccaccagacacagtgacacgagaact
ttgctcagcccttctggaagaaataaccgaaatgagggaacgctggactcacgtcgaacc
acaaccagacattctaagacgatggaggaattgaagctgccggagcacatggacagtagc
cattcccattcactgtctgcacctcacgaatctttttcttatggactgggctacaccagc
cccttttcttcccagcaacgtcctcataggcattctatgtatgtgacccgtgacaaagtg
agagccaagggcttggatggaagcttgagcatagggcaagggatggcagctagagccaac
agcctgcaactcttgtcaccccagcctggagaacagctccctccagagatgactgtggca
agatcttcggtcaaagagacctccagagaaggcacctcttccttccatacacgccagaag
tctgagggtggagtgtatcatgacccacactctgatgatggcacagcccccaaagaaaat
agacacctatacaatgatcctgtgccaaggagagttggtagcttttacagagtgccatct
ccacgtccagacaattctttccatgaaaataatgtgtcaactagagtttcttctctacca
tcagagagcagttctggaaccaaccactcaaaaagacaaccagcattcgatccatggaaa
agtcctgaaaatattagtcattcagagcaactcaaggaaaaagagaagcaaggatttttc
aggtcaatgaaaaagaaaaagaagaaatctcaaacagtacccaattccgacagccctgat
cttctgacgttgcagaaatccattcattctgctagcactccaagcagcagaccaaaggag
tggcgccccgagaagatctcagatctgcagacccaaagccagccattaaaatcactgcgc
aagttgttacatctctcttcggcctcaaatcacccggcttcctcagatccccgcttccag
cccttaacagctcaacaaaccaaaaattccttctcagaaattcggattcaccccctgagc
caggcctctggcgggagcagcaacatccggcaggaacccgcaccgaagggcaggccagcc
ctccagctgccaggtcagatggatcctggttggcatgtgtcctctgtgaccaggagtgcc
acagagggcccttcctactctgaacagctgggtgccaaaagtgggccaaatgggcacccc
tataacagaacaaatcgctcacgaatgccaaatctgaatgatttaaaagagacagccttg
taa

DBGET integrated database retrieval system