KEGG   Homo sapiens (human): 6793Help
Entry
6793              CDS       T01001                                 

Gene name
STK10, LOK, PRO2729
Definition
(RefSeq) serine/threonine kinase 10
  KO
K08837  serine/threonine kinase 10 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6793 (STK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6793 (STK10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6793 (STK10)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   6793 (STK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKK Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 6793
NCBI-ProteinID: NP_005981
OMIM: 603919
HGNC: 11388
Ensembl: ENSG00000072786
Vega: OTTHUMG00000163265
Pharos: O94804(Tchem)
UniProt: O94804
Structure
PDB: 

Position
5q35.1
AA seq 968 aa AA seqDB search
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSN
KALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPPSLNADKPLEE
SPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDA
RIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGP
SKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEV
SITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQ
EINAKKKFFDTELENLERQQKQQVEKMEQDHAVRRREEARRIRLEQDRDYTRFQEQLKLM
KKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVAKQKEDLELAMKRLTTDNRRE
ICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQRHELLRKHEKE
REQMQRYNQRMIEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKI
KQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLK
ALDESHNQNLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFF
PYSSADAS
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgccaatttccgccgcatcctgcgcctgtctaccttcgagaagagaaagtcc
cgcgaatatgagcacgtccgccgcgacctggaccccaacgaggtgtgggagatcgtgggc
gagctgggcgacggcgccttcggcaaggtttacaaggccaagaataaggagacgggtgct
ttggctgcggccaaagtcattgaaaccaagagtgaggaggagctggaggactacatcgtg
gagattgagatcctggccacctgcgaccacccctacattgtgaagctcctgggagcctac
tatcacgacgggaagctgtggatcatgattgagttctgtccagggggagccgtggacgcc
atcatgctggagctggacagaggcctcacggagccccagatacaggtggtttgccgccag
atgctagaagccctcaacttcctgcacagcaagaggatcatccaccgagatctgaaagct
ggcaacgtgctgatgaccctcgagggagacatcaggctggctgactttggtgtgtctgcc
aagaatctgaagactctacagaaacgagattccttcatcggcacgccttactggatggcc
cccgaggtggtcatgtgtgagaccatgaaagacacgccctacgactacaaagccgacatc
tggtccctgggcatcacgctgattgagatggcccagatcgagccgccacaccacgagctc
aaccccatgcgggtcctgctaaagatcgccaagtcggaccctcccacgctgctcacgccc
tctaagtggtctgtagagttccgtgacttcctgaagatagccctggataagaacccagaa
acccgacccagtgccgcgcagctgctggagcatcccttcgtcagcagcatcaccagtaac
aaggctctgcgggagctggtggctgaggccaaggccgaggtgatggaagagatcgaagac
ggccgggatgagggggaagaggaggacgccgtggatgccgcctccaccctggagaaccat
actcagaactcctctgaggtgagtccgccaagcctcaatgctgacaagcctctcgaggag
tcaccttccaccccgctggcacccagccagtctcaggacagtgtgaatgagccctgcagc
cagccctctggggacagatccctccaaaccaccagtcccccagtcgtggcccctggaaat
gagaacggcctggcagtgcctgtgcccctgcggaagtcccgacccgtgtcaatggatgcc
agaattcaggtagcccaggagaagcaagttgctgagcagggtggggacctcagcccagca
gccaacagatctcaaaaggccagccagagccggcccaacagcagcgccctggagaccttg
ggtggggagaagctggccaatggcagcctggagccacctgcccaggcagctccagggcct
tccaagagggactcggactgcagcagcctctgcacctctgagagcatggactatggtacc
aatctctccactgacctgtcgctgaacaaagagatgggctctctgtccatcaaggacccg
aaactgtacaaaaaaaccctcaagcggacacgcaaatttgtggtggatggtgtggaggtg
agcatcaccacctccaagatcatcagcgaagatgagaagaaggatgaggagatgagattt
ctcaggcgccaggaactccgagagcttcggctgctccagaaagaagagcatcggaaccag
acccagctgagtaacaagcatgagctgcagctggagcaaatgcataaacgttttgaacag
gaaatcaacgccaagaagaagttctttgacacggaattagagaacctggagcgtcagcaa
aagcagcaagtggagaagatggagcaagaccatgccgtgcgccgccgggaggaggccagg
cggatccgcctggagcaggatcgggactacaccaggttccaagagcagctcaaactgatg
aagaaagaggtgaagaacgaggtggagaagctcccccgacagcagcggaaggaaagcatg
aagcagaagatggaggagcacacgcagaaaaagcagcttcttgaccgggactttgtagcc
aagcagaaggaggacctggagctggccatgaagaggctcaccaccgacaacaggcgggag
atctgtgacaaggagcgcgagtgcctcatgaagaagcaggagctccttcgagaccgggaa
gcagccctgtgggagatggaagagcaccagctgcaggagaggcaccagctggtgaagcag
cagctcaaagaccagtacttcctccagcggcacgagctgctgcgcaagcatgagaaggag
cgggagcagatgcagcgctacaaccagcgcatgatagagcagctgaaggtgcggcagcaa
caggaaaaggcgcggctgcccaagatccagaggagtgagggcaagacgcgcatggccatg
tacaagaagagcctccacatcaacggcgggggcagcgcagctgagcagcgtgagaagatc
aagcagttctcccagcaggaggagaagaggcagaagtcggagcggctgcagcaacagcag
aaacacgagaaccagatgcgggacatgctggcgcagtgtgagagcaacatgagcgagctg
cagcagctgcagaatgaaaagtgccacctcctggtagagcacgaaacccagaaactgaag
gccctggatgagagccataaccagaacctgaaggaatggcgggacaagcttcggccgcgc
aagaaggctctggaagaggatctgaaccagaagaagcgggagcaggagatgttcttcaag
ctgagcgaggaggcggagtgcccaaacccctccaccccaagcaaggccgccaagttcttc
ccctacagttctgcggatgcttcttaa

DBGET integrated database retrieval system